BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_H09_e168_15.seq (1513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 4.3 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 7.6 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 25.4 bits (53), Expect = 4.3 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 642 TSAKMRIRIIPTNNLGCWAVPRT--PASPTMPMAKPAARPEKPTARPAPK 499 TS R + P + L A PR P +KP A P+ +A PAP+ Sbjct: 68 TSVDCRTSLAPCSKLFA-AEPRVALPKLSATGASKPIAEPKAASATPAPE 116 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.6 bits (51), Expect = 7.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 276 LPSSSAPLVLHMAQPSQAPVLP 341 LP+++ P+ +M QPS PV P Sbjct: 808 LPATAEPMGDYMIQPSNIPVHP 829 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,312,514 Number of Sequences: 2352 Number of extensions: 28102 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 177188220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -