Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030712_H08_e160_16.seq
         (1509 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6STP7 Cluster: Predicted protein; n=1; Botryotinia fuc...    35   4.8  

>UniRef50_A6STP7 Cluster: Predicted protein; n=1; Botryotinia
           fuckeliana B05.10|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 169

 Score = 35.1 bits (77), Expect = 4.8
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
 Frame = -1

Query: 381 TMHAQPSRQYDTQKLASQHTRRAQLSRHPEVS*STYNARAPSRKNDTLRLAIKVL-GFSI 205
           +MHA P+  YDT  L   HT   Q +   + S      R PS    T   A+ +L GF  
Sbjct: 44  SMHAVPNLLYDTSWLTLLHTMEPQDAAGKQASAFARCVRCPSHAGTTADSAVPILDGFGA 103

Query: 204 VSPKKYNFLRAY 169
           V+ K  +  + Y
Sbjct: 104 VTIKDEHMSKKY 115


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,108,068,315
Number of Sequences: 1657284
Number of extensions: 18596176
Number of successful extensions: 29003
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 27909
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28993
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 160505231050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)