BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_H08_e160_16.seq (1509 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 27 0.42 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 27 0.42 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 27 0.42 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 27 0.42 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 25 1.3 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 24 3.9 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 9.1 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 9.1 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 9.1 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 9.1 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 9.1 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 9.1 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 9.1 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 9.1 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 9.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 9.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 9.1 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 27.1 bits (57), Expect = 0.42 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 622 VSMYSYIQLQENNSQYLINKQXIIDNLQYIIDYNSFVPAALPVFH 488 +S S + NN +Y N L Y I+Y +P +PV++ Sbjct: 82 ISSLSNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYY 126 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 27.1 bits (57), Expect = 0.42 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 622 VSMYSYIQLQENNSQYLINKQXIIDNLQYIIDYNSFVPAALPVFH 488 +S S + NN +Y N L Y I+Y +P +PV++ Sbjct: 82 ISSLSNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYY 126 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 27.1 bits (57), Expect = 0.42 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 622 VSMYSYIQLQENNSQYLINKQXIIDNLQYIIDYNSFVPAALPVFH 488 +S S + NN +Y N L Y I+Y +P +PV++ Sbjct: 82 ISSLSNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYY 126 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 27.1 bits (57), Expect = 0.42 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 622 VSMYSYIQLQENNSQYLINKQXIIDNLQYIIDYNSFVPAALPVFH 488 +S S + NN +Y N L Y I+Y +P +PV++ Sbjct: 82 ISSLSNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYY 126 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.4 bits (53), Expect = 1.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 589 NNSQYLINKQXIIDNLQYIIDYNSFVPAALPVFH 488 NN+ Y N L Y I+Y +P +PV++ Sbjct: 92 NNNNYKYNYNNNCKKLYYNINYIEQIPIPVPVYY 125 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 3.9 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 589 NNSQYLINKQXIIDNLQYIIDYNSFVPAALPV 494 NN+ Y N L Y I+Y VP +PV Sbjct: 92 NNNNYNNNNYNNYKKLYYNINYIEQVPVPIPV 123 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 92 YNYNNNYNNYNKHNYNKLYYNINYIEQI 119 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 325 YNYNNNYNNYNKHNYNKLYYNINYIEQI 352 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 389 YSHNFSLXRQKKYNFKKLFSN-DYLKAI 469 Y++N + K+N+ KL+ N +Y++ I Sbjct: 325 YNYNNNYNNYNKHNYNKLYYNINYIEQI 352 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 331,336 Number of Sequences: 438 Number of extensions: 6409 Number of successful extensions: 30 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 52754625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -