Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030712_H03_e120_15.seq
         (1518 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    23   4.5  

>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 23.4 bits (48), Expect = 4.5
 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 1/61 (1%)
 Frame = -3

Query: 463 TLMRLPTISAGNTRSSNMASYTEVSVLERGLFC-LLATRVLWLGLGRILRSPTNTTCLPL 287
           TL     + A N          +++VLE G FC +   R L +G+ R +++    + L  
Sbjct: 527 TLSNTSLLGAANQLEELNLKNIDLTVLESGAFCKMQPLRTLKIGVYRNIKNFNIPSILQF 586

Query: 286 N 284
           N
Sbjct: 587 N 587


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 282,865
Number of Sequences: 336
Number of extensions: 5884
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 45579125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)