BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_H03_e120_15.seq (1518 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 27 0.42 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 25 1.7 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 25 1.7 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 27.1 bits (57), Expect = 0.42 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 84 SXTSISQALVELETNSDLKAQLRE 155 S T++S AL EL N D++ +LRE Sbjct: 309 SSTTMSNALYELALNQDVQKKLRE 332 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 25.0 bits (52), Expect = 1.7 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +3 Query: 390 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYK 560 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T V+ YK Sbjct: 36 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMTTNLWVEQSWYDYK 89 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 25.0 bits (52), Expect = 1.7 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +3 Query: 390 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYK 560 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T V+ YK Sbjct: 36 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMTTNLWVEQSWYDYK 89 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 348,905 Number of Sequences: 438 Number of extensions: 7548 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 53113500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -