BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_G08_e159_14.seq (1516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0066 - 536281-537196,537397-537452 30 5.5 10_08_0211 + 15899017-15901392 29 9.6 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 1402 PMXXXGAPPPXXXGXNPXPS*TPXXXKXXRXPPP 1503 P +PPP P PS TP + PPP Sbjct: 223 PPPSPASPPPPSTATPPPPSPTPTTTRASPTPPP 256 >10_08_0211 + 15899017-15901392 Length = 791 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 496 KPICLEVFGKFAQVCAKFSDLAPTSDGLRGCLELEPKLLGEGQLDF 633 K +CL F + + +F DL+ SD + L K++G+G DF Sbjct: 238 KDMCLS-FALYRLLRCRFDDLSLPSDSVVNTRRLISKIIGKGNADF 282 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,356,464 Number of Sequences: 37544 Number of extensions: 576164 Number of successful extensions: 1154 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1153 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4861283252 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -