BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_G04_e127_14.seq (1506 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 26 2.5 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 26.2 bits (55), Expect = 2.5 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +1 Query: 88 SPPKFAEAVKALPVNSIS*VKKKSFIDAASSMNPLKT-HISDYQSARVIYSIKLRVDMNK 264 SP + E + PV ++ ++ +D ASS+NP K + +A + +I+ D+ K Sbjct: 403 SPGQVLERGEEEPVRDVN---EQELLDIASSLNPRKAPGLDGVPNAALTAAIRKHTDIFK 459 Query: 265 RIYTQ 279 +++ + Sbjct: 460 KLFQE 464 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,190,658 Number of Sequences: 2352 Number of extensions: 22147 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 176375430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -