BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_F10_e174_12.seq (1541 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21B10.09 |||acetyl-CoA transporter |Schizosaccharomyces pomb... 27 5.2 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 27 9.1 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 27 9.1 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 9.1 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 9.1 >SPBC21B10.09 |||acetyl-CoA transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 519 Score = 27.5 bits (58), Expect = 5.2 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -2 Query: 397 GRIGYRAPPRVFFFFFSLRLISVLLNQIIIFYFLAPPWQHGLP 269 GRI P ++ + R++S+LLN I++ ++ W+H P Sbjct: 333 GRISNYRPLDIWLKGYWGRVVSILLNTILV--YMVSNWKHRFP 373 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 26.6 bits (56), Expect = 9.1 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 103 PALKP*PERIGTQLIPP-PCLRRATHVKARAAEERLPAGPIAPVAPTVP 246 P + P+R ++P P + + V +P P+APVAP VP Sbjct: 539 PEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQPPVAPVAPEVP 587 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 208 PAGPIAPVAPTVPVGMGNHPEASHAA 285 P P AP+AP +P GM P AA Sbjct: 448 PLPPSAPIAPPLPAGMPAAPPLPPAA 473 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 9.1 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +3 Query: 387 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 551 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 552 SCA 560 S A Sbjct: 232 SDA 234 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 494 PPFASWRNSEEARTDRPSQQLRSLN 568 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,534,244 Number of Sequences: 5004 Number of extensions: 80730 Number of successful extensions: 162 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 866210038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -