BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030712_F09_e166_11.seq
(1489 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-... 27 5.0
>SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl
cis-trans isomerase Cyp7|Schizosaccharomyces pombe|chr
2|||Manual
Length = 463
Score = 27.5 bits (58), Expect = 5.0
Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
Frame = +3
Query: 54 PGLQXIRHE-GGLYCGKNEGGNSHYFCSLIGGRQLPSRQT*F 176
P L+ IR G+ C +NEG NS +F +L + +QT F
Sbjct: 89 PRLRFIRRGLVGMACTENEGNNSQFFITLGPTPEWNGKQTLF 130
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,973,370
Number of Sequences: 5004
Number of extensions: 45545
Number of successful extensions: 95
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 90
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 95
length of database: 2,362,478
effective HSP length: 76
effective length of database: 1,982,174
effective search space used: 830530906
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -