BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_F04_e126_12.seq (1448 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0646 - 26385447-26385463,26385546-26385657,26385838-263859... 31 3.0 >03_05_0646 - 26385447-26385463,26385546-26385657,26385838-26385957, 26386120-26386371 Length = 166 Score = 30.7 bits (66), Expect = 3.0 Identities = 28/103 (27%), Positives = 41/103 (39%), Gaps = 4/103 (3%) Frame = +3 Query: 144 HKRDKDAI----YGHPLFPLLALIFEKCELATCTPRDPGVAGGDVCSSESFNEDIXVFSK 311 H+R+ DAI HPL+P L F C+ P G +S ED + + Sbjct: 55 HERETDAIKAKIMSHPLYPALLRAFIDCQKVGAPPEVVGRLSALAGELDSRAEDRYLQGQ 114 Query: 312 QIRQEKPYYIADPEVDSLMVQAIQVLRFHLLELEKVHELCDNF 440 +DPE+D M I +L + EL + + D F Sbjct: 115 S---------SDPELDEFMETYIDMLVSYRQELTRPIQEADQF 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,085,119 Number of Sequences: 37544 Number of extensions: 244177 Number of successful extensions: 645 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 644 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4606036876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -