BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_F03_e118_11.seq (1546 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) 29 7.5 SB_23389| Best HMM Match : LRR_3 (HMM E-Value=0.99) 29 7.5 >SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) Length = 1183 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +2 Query: 764 RLHIKNETXGKHRKAGVYTRLVHXGVKGSXXLQLTYFYRVLPNILYR 904 RL I+ + + +KAG + G+ QL FYR L N+L + Sbjct: 984 RLEIQEMSFRRQQKAGTENNIEGGGISSQDESQLHAFYRGLHNLLVK 1030 >SB_23389| Best HMM Match : LRR_3 (HMM E-Value=0.99) Length = 348 Score = 29.5 bits (63), Expect = 7.5 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 522 YFLYTVSILFSLIICLWVYTIFVS 593 +FL S++F+L I WVYT+++S Sbjct: 140 FFLAIASMIFTLQILSWVYTLYLS 163 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,216,620 Number of Sequences: 59808 Number of extensions: 530757 Number of successful extensions: 871 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5035506333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -