BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_F01_e102_11.seq (1492 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 25 1.9 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 7.7 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 24.6 bits (51), Expect = 1.9 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 10/63 (15%) Frame = +2 Query: 173 FQKIKLMTYMLRSQ----------ILPLQRSMSSISGVVENTMRNKLQKSLNTKHLEIIN 322 F K+K M Y++ Q I+P Q + +I + ++ R K L +K +++ Sbjct: 162 FHKLKKMKYLVEVQDEVKPRGVLNIIPKQDNFRAIVSIFPDSARKPFFKLLTSKIYKVLE 221 Query: 323 ESY 331 E Y Sbjct: 222 EKY 224 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.6 bits (46), Expect = 7.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 166 TSVSKDKTYDVYVKIANITSSTKHVFYI 249 TS S D+ + ++ I + KH++YI Sbjct: 456 TSASGDEACSLKDYVSRIKPNQKHIYYI 483 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 269,370 Number of Sequences: 336 Number of extensions: 5559 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 44657300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -