BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_E08_e157_10.seq (1503 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 26 2.5 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 5.7 Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 25 7.5 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 25 7.5 AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related ... 25 7.5 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 26.2 bits (55), Expect = 2.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 247 VSAGAAHSVKNHNRHGHHRH 188 + +GA H +N N H HH H Sbjct: 108 IGSGALHLGQNPNLHHHHHH 127 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.0 bits (52), Expect = 5.7 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 277 RMLGGYFADTVSAGAAHSVKNHNRHGHHRHTDCVYYNSLCLHXLRMPR 134 RML S +A+S+++H + HH+ + N L H + R Sbjct: 810 RMLPSGATGNNSTNSAYSMQSHQQQQHHQPSAVSNSNGLARHNSKSRR 857 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 24.6 bits (51), Expect = 7.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 211 CGSLHCARHRRIPYP 255 C H + RR+PYP Sbjct: 18 CAQAHASHQRRVPYP 32 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 24.6 bits (51), Expect = 7.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 278 SDAGRLLCGYGIRRCRAQCKEP 213 +DA C YG RCRA K P Sbjct: 107 ADANARSCNYGHDRCRATKKFP 128 >AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related 1 protein protein. Length = 178 Score = 24.6 bits (51), Expect = 7.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 278 SDAGRLLCGYGIRRCRAQCKEP 213 +DA C YG RCRA K P Sbjct: 107 ADANARSCNYGHDRCRATKKFP 128 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,142,952 Number of Sequences: 2352 Number of extensions: 20160 Number of successful extensions: 103 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 175969035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -