BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_E08_e157_10.seq (1503 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015255-1|AAT94484.1| 1100|Drosophila melanogaster LP07621p pro... 33 1.3 AE014298-2629|AAF48778.1| 163|Drosophila melanogaster CG7835-PA... 33 1.3 >BT015255-1|AAT94484.1| 1100|Drosophila melanogaster LP07621p protein. Length = 1100 Score = 32.7 bits (71), Expect = 1.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = -3 Query: 298 WVSMYLARMLGGYFADTVSAGAAHSVKNHNRHGHHRHTDCVYY 170 W + GG F+ ++ ++ S+ +H +GHH H +Y Sbjct: 77 WAPFVVGAAAGGSFSSSIITSSSSSLNHHPHNGHHNHHHPPHY 119 >AE014298-2629|AAF48778.1| 163|Drosophila melanogaster CG7835-PA protein. Length = 163 Score = 32.7 bits (71), Expect = 1.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = -3 Query: 298 WVSMYLARMLGGYFADTVSAGAAHSVKNHNRHGHHRHTDCVYY 170 W + GG F+ ++ ++ S+ +H +GHH H +Y Sbjct: 24 WAPFVVGAAAGGSFSSSIITSSSSSLNHHPHNGHHNHHHPPHY 66 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,054,197 Number of Sequences: 53049 Number of extensions: 839794 Number of successful extensions: 2011 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1963 length of database: 24,988,368 effective HSP length: 88 effective length of database: 20,320,056 effective search space used: 8371863072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -