BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_E07_e149_09.seq (1530 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0002 - 13567257-13567373,13568049-13568243,13569750-135698... 29 9.7 >09_04_0002 - 13567257-13567373,13568049-13568243,13569750-13569869, 13569958-13570028,13570066-13570126,13570170-13570202, 13570303-13570431,13571958-13572042,13572143-13572252, 13572534-13572606,13572688-13572810,13573111-13573289, 13573659-13573736,13573813-13573871,13574122-13574212, 13574265-13574442,13574553-13575088 Length = 745 Score = 29.1 bits (62), Expect = 9.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 586 LNNKNMPLEIIRTETG*YNLEMLTVLFEFTMDGCYNEF 699 L KN+ +E+ R E Y+LE L F+ D CY F Sbjct: 590 LYQKNLDIEVCR-EALLYSLEHRVALVAFSQDDCYTTF 626 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,164,157 Number of Sequences: 37544 Number of extensions: 604174 Number of successful extensions: 833 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4919293792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -