BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_E04_e125_10.seq (1522 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. 276 1e-75 Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 226 1e-60 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 7.6 >AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. Length = 136 Score = 276 bits (676), Expect = 1e-75 Identities = 136/136 (100%), Positives = 136/136 (100%) Frame = +1 Query: 169 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 348 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 349 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 528 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 529 MPKDIQLARRIRGERA 576 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. Length = 115 Score = 226 bits (553), Expect = 1e-60 Identities = 110/115 (95%), Positives = 113/115 (98%) Frame = +1 Query: 175 RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELL 354 RTKQTARKSTGGKAPRKQLA KAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELL Sbjct: 1 RTKQTARKSTGGKAPRKQLARKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL 60 Query: 355 IRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR 519 IRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKR Sbjct: 61 IRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 115 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.6 bits (51), Expect = 7.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 402 VLSNFSNESLERQLADQQLRRFLIATNFSKRYS 304 +LSNF + SL AD + + A N R+S Sbjct: 1029 LLSNFGSSSLSAPTADNETNKIAEAFNRISRFS 1061 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,088,005 Number of Sequences: 2352 Number of extensions: 17823 Number of successful extensions: 67 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 178407405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -