BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_E03_e117_09.seq (1521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 >SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 73.3 bits (172), Expect = 5e-13 Identities = 37/79 (46%), Positives = 42/79 (53%) Frame = +2 Query: 98 KLSPXKIXNPLFEKRXXNFAIGQDIQPTRDLSCFVRWXKYIRIXRQKAXSQXXXKVPPPI 277 K P K NPL EKR NF IG DIQP RDLS FVRW +Y+++ RQK+ KVPP I Sbjct: 21 KAVPKKTVNPLIEKRPRNFGIGGDIQPKRDLSRFVRWPRYVKLQRQKSLLYQRLKVPPAI 80 Query: 278 XXXXXXXXXXXXXGLFXXL 334 LF L Sbjct: 81 NQFTQALDRQSTVQLFKLL 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,289,122 Number of Sequences: 59808 Number of extensions: 127743 Number of successful extensions: 105 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4941604117 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -