BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_D10_e172_08.seq (1510 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 291 1e-78 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 1e-21 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 95 1e-19 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 93 5e-19 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 1e-18 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 5e-18 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 6e-18 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 89 9e-18 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 1e-17 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 1e-17 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 87 3e-17 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 8e-17 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 2e-16 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 6e-16 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-14 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-14 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 8e-13 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-10 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 62 1e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 61 3e-09 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 61 3e-09 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 61 3e-09 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 60 5e-09 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 60 5e-09 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 60 5e-09 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 60 5e-09 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 60 5e-09 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 60 5e-09 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 60 5e-09 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 60 5e-09 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 60 5e-09 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 60 5e-09 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 60 5e-09 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 60 5e-09 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 60 5e-09 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 60 5e-09 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 60 5e-09 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 60 5e-09 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 60 5e-09 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 60 5e-09 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 60 5e-09 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 60 5e-09 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 60 5e-09 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 60 5e-09 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 60 5e-09 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 60 5e-09 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 60 5e-09 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 60 5e-09 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 60 5e-09 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 60 5e-09 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 60 5e-09 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 60 5e-09 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 60 5e-09 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 60 5e-09 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 60 5e-09 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 60 5e-09 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 60 5e-09 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 60 5e-09 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 60 5e-09 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 60 5e-09 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 60 5e-09 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 60 5e-09 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 60 5e-09 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 60 5e-09 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 60 5e-09 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 60 5e-09 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 60 5e-09 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 60 5e-09 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 60 6e-09 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 58 1e-08 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 58 2e-08 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-08 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 56 7e-08 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 56 7e-08 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 56 7e-08 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 56 7e-08 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 56 7e-08 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 56 7e-08 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 56 7e-08 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 56 7e-08 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 56 7e-08 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 56 7e-08 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 56 7e-08 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 56 7e-08 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 56 7e-08 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 56 7e-08 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 56 7e-08 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 56 7e-08 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 56 7e-08 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 56 7e-08 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 56 7e-08 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 56 7e-08 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 56 7e-08 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 56 7e-08 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 56 7e-08 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 56 7e-08 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 56 7e-08 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 56 7e-08 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 56 7e-08 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 56 7e-08 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 56 7e-08 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 56 7e-08 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 56 7e-08 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 56 7e-08 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 56 7e-08 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 56 7e-08 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 56 7e-08 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 56 7e-08 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 56 7e-08 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 56 7e-08 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 56 7e-08 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 56 7e-08 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 56 7e-08 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 56 7e-08 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 56 7e-08 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 56 7e-08 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 56 7e-08 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 56 7e-08 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 56 7e-08 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 56 7e-08 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 56 7e-08 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 56 7e-08 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 56 7e-08 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 56 7e-08 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 291 bits (713), Expect = 1e-78 Identities = 132/181 (72%), Positives = 157/181 (86%) Frame = +3 Query: 135 DEIRLARQARNRGNYYVPGEAKLAFVIRIRGVNQVSPKVRKVLQLFRLRQINNGVFVRLN 314 DE+R+ + A+ GN+YVP EA+LAFVIRIRG+N VSPKVRK+LQL RLRQINNGVFVRLN Sbjct: 64 DELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSPKVRKILQLLRLRQINNGVFVRLN 123 Query: 315 KATVNMLRIAEPYIAWGYPNLKSVRELVYKRGFAKLNGKRVPITSNSLIEKRLSKQNIIC 494 KAT NMLRI +PYIA+GYPNLKSVREL+YKRG+ K++ +RV +T NS++EK L K IIC Sbjct: 124 KATANMLRIVQPYIAFGYPNLKSVRELIYKRGYGKVDKQRVALTDNSIVEKVLGKHGIIC 183 Query: 495 VEDLIHEIFTVGEKFKYASNFLWPFKLNNPTGGWRKKTIHYVDGGDFGNREDKVNELLRR 674 VEDLIHEIFTVGE FK ASNFLWPFKL++P GG+RKKT H+V+GGD GNREDK+N L+R Sbjct: 184 VEDLIHEIFTVGEHFKEASNFLWPFKLSSPKGGFRKKTTHFVEGGDHGNREDKINGLVRV 243 Query: 675 M 677 M Sbjct: 244 M 244 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 101 bits (243), Expect = 1e-21 Identities = 49/63 (77%), Positives = 51/63 (80%) Frame = -2 Query: 933 IQAAQLLGXGRSGXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHYR 754 IQAAQLLG G FAITP+ +G MCCKAIKLGNA V PSHDVVKRRPVNCNTTHYR Sbjct: 7 IQAAQLLGRA-IGAGLFAITPAGERG-MCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYR 64 Query: 753 ANW 745 ANW Sbjct: 65 ANW 67 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 95.1 bits (226), Expect = 1e-19 Identities = 45/63 (71%), Positives = 50/63 (79%) Frame = -2 Query: 933 IQAAQLLGXGRSGXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHYR 754 +QAAQLLG G FAITP+ +G MCCK+IKL +A V PSHDVVKRRPVNCNTTHYR Sbjct: 1 MQAAQLLGRA-IGAGLFAITPAGERG-MCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYR 58 Query: 753 ANW 745 ANW Sbjct: 59 ANW 61 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 93.1 bits (221), Expect = 5e-19 Identities = 41/51 (80%), Positives = 43/51 (84%) Frame = -2 Query: 897 GXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHYRANW 745 G FAITP+ +G MCCKAIKLGNA V PSHDVVKRRPVNCNTTHYRANW Sbjct: 4 GAGLFAITPAGERG-MCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 91.9 bits (218), Expect = 1e-18 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 89.8 bits (213), Expect = 5e-18 Identities = 46/63 (73%), Positives = 48/63 (76%) Frame = -2 Query: 933 IQAAQLLGXGRSGXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHYR 754 IQAAQLLG G FAITP+ +G MCCKAIKL V PSHDVVKRRPVNCNTTHYR Sbjct: 1840 IQAAQLLGRA-IGAGLFAITPAGERG-MCCKAIKLVTP-VFPSHDVVKRRPVNCNTTHYR 1896 Query: 753 ANW 745 ANW Sbjct: 1897 ANW 1899 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 89.4 bits (212), Expect = 6e-18 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 885 FAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHYRANW 745 FAITP+ +G MCCKAIKLGNA+ PSHDVVKRRPVNCNTTHYRANW Sbjct: 14 FAITPAGERG-MCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 89.0 bits (211), Expect = 9e-18 Identities = 47/70 (67%), Positives = 52/70 (74%) Frame = +1 Query: 727 EGGARYPIRPIVSRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSP 906 +GGA PIRPIVSRITIHWP+FYN TG TQLNRLAAHPPF+ + RNS+ P Sbjct: 35 DGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFA-SWRNSQEARADRP 91 Query: 907 XSQQLRSLNG 936 SQQLRSLNG Sbjct: 92 -SQQLRSLNG 100 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 88.6 bits (210), Expect = 1e-17 Identities = 45/58 (77%), Positives = 47/58 (81%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG N GVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 88.6 bits (210), Expect = 1e-17 Identities = 45/58 (77%), Positives = 47/58 (81%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG N GVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 87.0 bits (206), Expect = 3e-17 Identities = 43/61 (70%), Positives = 46/61 (75%) Frame = -2 Query: 930 QAAQLLGXGRSGXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHYRA 751 + AQLLG G FAITP+ +G MCCKAIKLGNAR PSHD KRRPVNCNTTHYRA Sbjct: 39 RVAQLLGRS-IGAGLFAITPAGERG-MCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRA 96 Query: 750 N 748 N Sbjct: 97 N 97 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 85.8 bits (203), Expect = 8e-17 Identities = 44/58 (75%), Positives = 46/58 (79%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVV NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 84.6 bits (200), Expect = 2e-16 Identities = 41/64 (64%), Positives = 45/64 (70%) Frame = -2 Query: 936 PIQAAQLLGXGRSGXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHY 757 P QAAQLLG G FAITP+ KG + +KLG + PSHDVVKRRPVNCNTTHY Sbjct: 40 PSQAAQLLGRA-IGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHY 98 Query: 756 RANW 745 RANW Sbjct: 99 RANW 102 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 83.4 bits (197), Expect = 4e-16 Identities = 42/58 (72%), Positives = 45/58 (77%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNV+ PGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFA-SWRNSEKARTDRP-SQQLRSLNG 57 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 83.0 bits (196), Expect = 6e-16 Identities = 43/58 (74%), Positives = 45/58 (77%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG VTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 81.8 bits (193), Expect = 1e-15 Identities = 43/63 (68%), Positives = 46/63 (73%) Frame = +1 Query: 748 IRPIVSRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRS 927 IRPIVSRITIHWPSFY NPGV QLNRLAAHPPF+ + R+SE P SQQLR Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFA-SWRSSEEARTDRP-SQQLRR 75 Query: 928 LNG 936 LNG Sbjct: 76 LNG 78 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 76.6 bits (180), Expect = 5e-14 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = +1 Query: 778 HWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 HWPSFYNVVTG GVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 55 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 76.6 bits (180), Expect = 5e-14 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 855 GMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHYRAN 748 GMCCKAIKLGNA V SHDVVKRRPVNCNTTHYRAN Sbjct: 5 GMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 72.5 bits (170), Expect = 8e-13 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = +1 Query: 760 VSRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 +SRITIHWPS NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 333 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 71.3 bits (167), Expect = 2e-12 Identities = 38/58 (65%), Positives = 41/58 (70%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG + L LAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.1 bits (154), Expect = 7e-11 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = +1 Query: 793 YNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 YNVVTG PGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 65.7 bits (153), Expect = 9e-11 Identities = 35/58 (60%), Positives = 39/58 (67%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG + L L HPPF+ + RNSE P SQ+LRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFA-SWRNSEEARTDRP-SQRLRSLNG 57 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 64.1 bits (149), Expect = 3e-10 Identities = 36/63 (57%), Positives = 40/63 (63%) Frame = +1 Query: 748 IRPIVSRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRS 927 +RP+VSRITIHW SFYNVVTG + L L H P SPA +E P SQQLRS Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAEEARTDRP-SQQLRS 90 Query: 928 LNG 936 LNG Sbjct: 91 LNG 93 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 63.7 bits (148), Expect = 4e-10 Identities = 36/58 (62%), Positives = 37/58 (63%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG + L L H P SPA NSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVNSEEARTDRP-SQQLRSLNG 57 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 62.9 bits (146), Expect = 6e-10 Identities = 35/61 (57%), Positives = 38/61 (62%) Frame = +1 Query: 754 PIVSRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLN 933 P +SRITIHWPSFYNVVTG + L L H P SPA + E P SQQLRSLN Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGLHREEARTDRP-SQQLRSLN 134 Query: 934 G 936 G Sbjct: 135 G 135 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 62.5 bits (145), Expect = 9e-10 Identities = 35/58 (60%), Positives = 38/58 (65%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG + L L PPF+ + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 62.1 bits (144), Expect = 1e-09 Identities = 41/69 (59%), Positives = 43/69 (62%) Frame = +1 Query: 730 GGARYPIRPIVSRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPX 909 GGA PIRPIVS ITIHWPSFYN VT AHPPF+ + RNSE P Sbjct: 38 GGA--PIRPIVSHITIHWPSFYNGVT-------------AHPPFA-SWRNSEEARTDRP- 80 Query: 910 SQQLRSLNG 936 SQQLRSLNG Sbjct: 81 SQQLRSLNG 89 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 62.1 bits (144), Expect = 1e-09 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -2 Query: 882 AITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNTTHYRANW 745 A TPS K M ++ +A V PSHDVVKRRPVNCNTTHYRANW Sbjct: 15 ATTPSGDKS-MYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 60.9 bits (141), Expect = 3e-09 Identities = 33/67 (49%), Positives = 39/67 (58%) Frame = -2 Query: 945 AHSPIQAAQLLGXGRSGXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNT 766 +HSP + GRS A ++ KGG + + G PSHDVVKRRPVNCNT Sbjct: 588 SHSPFRLRNCW-EGRSVRAS-SLLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNT 641 Query: 765 THYRANW 745 THYRANW Sbjct: 642 THYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 60.9 bits (141), Expect = 3e-09 Identities = 33/67 (49%), Positives = 39/67 (58%) Frame = -2 Query: 945 AHSPIQAAQLLGXGRSGXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNT 766 +HSP + GRS A ++ KGG + + G PSHDVVKRRPVNCNT Sbjct: 31 SHSPFRLRNCW-EGRSVRAS-SLLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNT 84 Query: 765 THYRANW 745 THYRANW Sbjct: 85 THYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 60.9 bits (141), Expect = 3e-09 Identities = 33/67 (49%), Positives = 39/67 (58%) Frame = -2 Query: 945 AHSPIQAAQLLGXGRSGXAXFAITPSWRKGGMCCKAIKLGNARVXPSHDVVKRRPVNCNT 766 +HSP + GRS A ++ KGG + + G PSHDVVKRRPVNCNT Sbjct: 31 SHSPFRLRNCW-EGRSVRAS-SLLRQLAKGGCAARRLSWG----FPSHDVVKRRPVNCNT 84 Query: 765 THYRANW 745 THYRANW Sbjct: 85 THYRANW 91 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 474 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 512 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 511 GFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 6 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 44 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 218 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 256 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 255 GFSQSRRCKTTASEL 269 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 67 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 105 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 104 GFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 648 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 686 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 685 GFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 373 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 411 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 410 GFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 289 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 327 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 326 GFSQSRRCKTTASEL 340 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 557 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 595 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 594 GFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 181 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 219 Score = 52.8 bits (121), Expect = 7e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 N GVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 526 NTGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 564 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 6 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 44 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 6 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 44 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 96 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 134 Score = 34.7 bits (76), Expect = 0.20 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -1 Query: 817 GFXQSRRCKTTASEL*YDSL*GELGTGPPPR 725 GF QSRRCKTTASE D L E PPPR Sbjct: 43 GFSQSRRCKTTASEFPGDPLVLE---RPPPR 70 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 6 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 44 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 6 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 44 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 29 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 67 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 66 GFSQSRRCKTTASEL 80 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 34 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 72 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 71 GFSQSRRCKTTAS 83 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 13 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 51 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 50 GFSQSRRCKTTAS 62 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 263 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 301 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 300 GFSQSRRCKTTASEL 314 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 190 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 228 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 227 GFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 447 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 485 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 484 GFSQSRRCKTTASEL 498 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 282 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 320 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 319 GFSQSRRCKTTASEL 333 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 132 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 170 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 169 GFSQSRRCKTTASEL 183 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 6 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 44 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 916 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 954 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 953 GFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 6 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 44 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 583 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 621 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 620 GFSQSRRCKTTASEL 634 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 264 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 302 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 301 GFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 497 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 535 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 534 GFSQSRRCKTTASEL 548 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 181 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 219 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 817 GFXQSRRCKTTASEL 773 GF QSRRCKTTASEL Sbjct: 218 GFSQSRRCKTTASEL 232 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 38.7 bits (86), Expect = 0.012 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -1 Query: 934 HSGCATVGKXAIGXGLXRYYAXLAKRGDVLQGD 836 HSGCATVGK G RYYA ++GDVLQGD Sbjct: 88 HSGCATVGK-GDRCGPLRYYASW-RKGDVLQGD 118 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 70 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 108 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 107 GFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 60.1 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = -3 Query: 935 PFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 PFRLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 21 PFRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 59 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 58 GFSQSRRCKTTAS 70 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 59.7 bits (138), Expect = 6e-09 Identities = 40/75 (53%), Positives = 44/75 (58%), Gaps = 7/75 (9%) Frame = +1 Query: 733 GARYPIRPIVSRITIHWPSFYNVVT-------GXNPGVTQLNRLAAHPPFSPAXRNSEXG 891 G YP P SR H S+YN + NPGVTQLNRLAAHPPF+ + RNSE Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEA 97 Query: 892 PPRSPXSQQLRSLNG 936 P SQQLRSLNG Sbjct: 98 RTDRP-SQQLRSLNG 111 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 58.4 bits (135), Expect = 1e-08 Identities = 35/61 (57%), Positives = 40/61 (65%), Gaps = 7/61 (11%) Frame = +1 Query: 775 IHWPSFYNVVT-------GXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLN 933 IH+ S+YN + NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLN Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLN 1521 Query: 934 G 936 G Sbjct: 1522 G 1522 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 58.4 bits (135), Expect = 1e-08 Identities = 33/58 (56%), Positives = 35/58 (60%) Frame = +1 Query: 763 SRITIHWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 SRITIHWPSFYNVVTG N G + P + RNSE P SQQLRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRP-SQQLRSLNG 58 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 58.0 bits (134), Expect = 2e-08 Identities = 30/49 (61%), Positives = 33/49 (67%) Frame = -3 Query: 959 NAYNLPIRPFRLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 + Y++ R RLRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 1095 HGYDVTARRGRLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 1141 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 817 GFXQSRRCKTTAS 779 GF QSRRCKTTAS Sbjct: 1140 GFSQSRRCKTTAS 1152 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 58.0 bits (134), Expect = 2e-08 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +1 Query: 808 GXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 G NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 38 GENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.0 bits (134), Expect = 2e-08 Identities = 32/53 (60%), Positives = 33/53 (62%) Frame = +1 Query: 778 HWPSFYNVVTGXNPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 HWPSFYNVVTG + L L H P SPA RNSE P SQQLRSLNG Sbjct: 5 HWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGRNSEEARTDRP-SQQLRSLNG 55 Score = 40.7 bits (91), Expect = 0.003 Identities = 24/45 (53%), Positives = 27/45 (60%) Frame = +2 Query: 809 GKTLALPNLIALQHIPPFRQLGVIAXKAXPDRPFPNSCAA*MGEW 943 GKTLALPNLIALQHI P G + +A DRP + GEW Sbjct: 15 GKTLALPNLIALQHI-PLSPAGRNSEEARTDRP-SQQLRSLNGEW 57 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.2 bits (132), Expect = 3e-08 Identities = 32/55 (58%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = -2 Query: 906 GRSGXAXFAITPSWRKGGMCCKAIKLGNARVX-PSHDVVKRRPVNCNTTHYRANW 745 GRS A ++ KGG C A +L PSHDVVKRRPVNCNTTHYRANW Sbjct: 29 GRSVRAS-SLLRQLAKGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 53.2 bits (122), Expect = 5e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 929 RLRNCWEXGDRGGPXSLLRXAGEKGGCAARRLSWVTPGF 813 +LRNCWE G SLLR KGGCAARRLSWVTPGF Sbjct: 22 QLRNCWE-GRSVRASSLLRQLA-KGGCAARRLSWVTPGF 58 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 56.8 bits (131), Expect = 4e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 810 PSHDVVKRRPVNCNTTHYRANW 745 PSHDVVKRRPVNCNTTHYRANW Sbjct: 3 PSHDVVKRRPVNCNTTHYRANW 24 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 56.8 bits (131), Expect = 4e-08 Identities = 34/59 (57%), Positives = 39/59 (66%), Gaps = 7/59 (11%) Frame = +1 Query: 781 WPSFYNVVTGX-------NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 + S+YN + G NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 45 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 101 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 56.8 bits (131), Expect = 4e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 810 PSHDVVKRRPVNCNTTHYRANW 745 PSHDVVKRRPVNCNTTHYRANW Sbjct: 59 PSHDVVKRRPVNCNTTHYRANW 80 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 56.8 bits (131), Expect = 4e-08 Identities = 34/64 (53%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +1 Query: 754 PIVSRITIHWPSFYNVVTGX---NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLR 924 P++ R+ ++ S V+ NPGVTQLNRLAAHPPF+ + RNSE P SQQLR Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLR 107 Query: 925 SLNG 936 SLNG Sbjct: 108 SLNG 111 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.8 bits (131), Expect = 4e-08 Identities = 34/59 (57%), Positives = 39/59 (66%), Gaps = 7/59 (11%) Frame = +1 Query: 781 WPSFYNVVTGX-------NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 + S+YN + G NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 58 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 114 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 46 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 84 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 26 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 64 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 73 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 111 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 55 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 93 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 47 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 85 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 73 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 111 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 78 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 116 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 49 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 87 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 69 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 107 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 81 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 119 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 57 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 95 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 46 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 84 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 36 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 74 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 61 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 99 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 70 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 108 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 64 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 102 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 80 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 118 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 68 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 106 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 51 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 89 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 51 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 89 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 227 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 265 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 122 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 160 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 60 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 98 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 39 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 77 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 27 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 65 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 58 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 96 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 392 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 430 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 118 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 156 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 94 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 132 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 50 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 88 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 19 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 57 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 29 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 67 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 49 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 87 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 114 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 152 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 56 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 94 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 351 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 389 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 91 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 129 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 61 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 99 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 27 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 65 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 70 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 108 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 54 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 92 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 145 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 183 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 74 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 112 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 50 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 88 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 154 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 192 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 844 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 882 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 27 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 65 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 71 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 109 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 45 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 83 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 84 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 122 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 67 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 105 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 80 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 118 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 76 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 114 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 267 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 305 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 125 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 163 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 61 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 99 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 47 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 85 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 48 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 86 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 112 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 150 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 125 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 163 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 50 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 88 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 31 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 69 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 69 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 107 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 48 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 86 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 45 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 83 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 22 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 60 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 30 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 68 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 407 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 445 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 56 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 94 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 65 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 103 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 47 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 85 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 130 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 168 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 66 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 104 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 76 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 114 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 79 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 117 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 425 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 463 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 122 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 160 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 78 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 116 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 67 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 105 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 57 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 95 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 172 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 210 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 76 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 114 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 63 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 101 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 99 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 137 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 48 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 86 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 74 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 112 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 53 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 91 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 196 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 234 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 45 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 83 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 51 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 89 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 65 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 103 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 62 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 100 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 45 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 83 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 46 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 84 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 60 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 98 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 50 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 88 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 143 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 181 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 56.0 bits (129), Expect = 7e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 814 NPGVTQLNRLAAHPPFSPAXRNSEXGPPRSPXSQQLRSLNG 936 NPGVTQLNRLAAHPPF+ + RNSE P SQQLRSLNG Sbjct: 40 NPGVTQLNRLAAHPPFA-SWRNSEEARTDRP-SQQLRSLNG 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,162,674 Number of Sequences: 59808 Number of extensions: 687780 Number of successful extensions: 10948 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8289 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4894653009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -