BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_D02_e108_08.seq (1486 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 25 1.4 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 5.8 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.0 bits (52), Expect = 1.4 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -1 Query: 361 PMLVIKSRTLMPSKAFANRPGQYGSTSTAAAFSMVEIFSPVTATSSST 218 P VI + T PS +NR +G A A S V +P+ T+S+T Sbjct: 124 PSGVISTNTSPPSPILSNR---FGENEEADAASNVISSTPLPPTTSTT 168 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.0 bits (47), Expect = 5.8 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 8/56 (14%) Frame = +3 Query: 180 KAELACVYSALILVDD--------DVAVTGEKISTILKAAAVDVEPYWPGLFAKAL 323 K EL C+ + ++ D +V + EKI +L+ P PG FAK L Sbjct: 310 KTELGCLRAIILYNPDVRGIKSVQEVEMLREKIYGVLEEYTRTTHPNEPGRFAKLL 365 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,846 Number of Sequences: 336 Number of extensions: 3744 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 44452450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -