BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_D02_e108_08.seq (1486 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 3e-23 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 8e-18 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 1e-17 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 9e-15 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 9e-15 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 78 2e-14 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 8e-14 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 2e-13 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 3e-13 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 71 2e-12 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-12 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 71 3e-12 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 69 1e-11 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 69 1e-11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 68 2e-11 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 68 2e-11 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 68 2e-11 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 68 2e-11 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 68 2e-11 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 68 2e-11 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 68 2e-11 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-11 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 68 2e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 67 3e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 67 3e-11 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 66 5e-11 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 66 5e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 66 5e-11 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 66 5e-11 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 66 5e-11 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 66 5e-11 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 66 5e-11 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 66 5e-11 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 66 7e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 66 7e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 66 7e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 66 7e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 66 7e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 66 7e-11 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 66 7e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 66 7e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 66 7e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 66 7e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 66 7e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 66 7e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 66 7e-11 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 66 7e-11 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 66 7e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 66 7e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 66 7e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 66 7e-11 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 66 7e-11 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 66 7e-11 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 66 7e-11 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 66 7e-11 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 66 7e-11 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 66 7e-11 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 66 7e-11 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 66 7e-11 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 66 7e-11 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 66 7e-11 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 66 7e-11 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 66 7e-11 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 66 7e-11 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 66 7e-11 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 66 7e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 66 7e-11 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 66 7e-11 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 66 7e-11 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 66 7e-11 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 66 7e-11 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 66 7e-11 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 66 7e-11 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 66 7e-11 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 66 7e-11 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 66 7e-11 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 66 7e-11 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 66 7e-11 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 66 7e-11 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 66 7e-11 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 66 7e-11 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 66 7e-11 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 66 7e-11 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 66 7e-11 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-11 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 66 7e-11 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 66 9e-11 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) 65 1e-10 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 65 2e-10 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 65 2e-10 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-10 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 64 2e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 64 2e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 64 2e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 64 2e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 64 2e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 64 2e-10 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 64 2e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 64 2e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 64 2e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 64 2e-10 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 64 2e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 64 2e-10 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 64 2e-10 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 64 2e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 64 2e-10 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 64 2e-10 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 64 2e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 64 2e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 64 2e-10 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 64 2e-10 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 64 2e-10 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 64 2e-10 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 64 2e-10 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 64 2e-10 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 64 2e-10 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 64 2e-10 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 64 2e-10 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 64 2e-10 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 64 2e-10 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 >SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 107 bits (256), Expect = 3e-23 Identities = 54/111 (48%), Positives = 66/111 (59%) Frame = +3 Query: 171 MASKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 350 MAS +ELACVYSALIL DDDVA+T +KI T++KAA ++VEP+WPGLFAKAL+G N+ DLI Sbjct: 1 MASTSELACVYSALILHDDDVAITADKIETLVKAAKINVEPFWPGLFAKALQGHNIADLI 60 Query: 351 TNIGSGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFGLFD 503 + G+ DDDMGFGLFD Sbjct: 61 LSAGA-PGAGGAVAAAPAAGGEAKAEEKKEEAKKEESEEESDDDMGFGLFD 110 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 89.0 bits (211), Expect = 8e-18 Identities = 40/45 (88%), Positives = 42/45 (93%), Gaps = 1/45 (2%) Frame = -2 Query: 765 ITPAGERGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 634 ITPAGE+GDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 58 ITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 88.2 bits (209), Expect = 1e-17 Identities = 41/48 (85%), Positives = 41/48 (85%) Frame = +1 Query: 652 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRN*RRGPAPDRP 795 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRN DRP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRN-SEEARTDRP 48 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 81.0 bits (191), Expect = 2e-15 Identities = 39/48 (81%), Positives = 39/48 (81%) Frame = +1 Query: 652 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRN*RRGPAPDRP 795 SRITIHWPSFYNVVTGKTLALPNLIALQ PPFASWRN DRP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRN-SEEARTDRP 48 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 79.0 bits (186), Expect = 9e-15 Identities = 38/48 (79%), Positives = 38/48 (79%) Frame = +1 Query: 652 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRN*RRGPAPDRP 795 SRITIHWPSFYNVVTGKTLALPNLIAL PPFASWRN DRP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRN-SEEARTDRP 48 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 79.0 bits (186), Expect = 9e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 763 YASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 YASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 77 YASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 78.2 bits (184), Expect = 2e-14 Identities = 41/61 (67%), Positives = 43/61 (70%) Frame = +1 Query: 613 TRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRN*RRGPAPDR 792 T GGA PIRPIVSRITIHWP+FYN TGKTLA L L PPFASWRN + A DR Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARA-DR 90 Query: 793 P 795 P Sbjct: 91 P 91 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 75.8 bits (178), Expect = 8e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 637 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIP 744 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIP Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 75.4 bits (177), Expect = 1e-13 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 765 ITPAGERGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 634 ITPAGERG + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 16 ITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.5 bits (175), Expect = 2e-13 Identities = 37/51 (72%), Positives = 37/51 (72%) Frame = -1 Query: 814 AXQXLGXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 A Q LG DR G YASWRKG RRLSWVTPGFSQSRRCKTTASEL Sbjct: 1 AAQLLGKGDRC-GPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 73.7 bits (173), Expect = 3e-13 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = +1 Query: 667 HWPSFYNVVTGKTLALPNLIALQHIPPFASWRN*RRGPAPDRP 795 HWPSFYN VTGKTLALPNLIALQHIP FASWRN + DRP Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRN-SQEARTDRP 46 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 73.3 bits (172), Expect = 4e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 643 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIP 744 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 71.3 bits (167), Expect = 2e-12 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = -2 Query: 765 ITPAGERGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 634 ITPAGERG + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 10 ITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 71.3 bits (167), Expect = 2e-12 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = -2 Query: 765 ITPAGERGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 634 ITPAGERG + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 24 ITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 Score = 42.3 bits (95), Expect = 0.001 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = -3 Query: 833 LPLAIQGXATVGXGRSGAGPLR*LRQLAKGGMCCKAIKLGNARVFP 696 +P AIQ +G GAG L + + GMCCKAIKLGNA VFP Sbjct: 3 VPFAIQAAQLLGRA-IGAG-LFAITPAGERGMCCKAIKLGNASVFP 46 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 652 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 744 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 652 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 744 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 68.9 bits (161), Expect = 1e-11 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = -2 Query: 765 ITPAGERGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 634 ITPAGERG + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 18 ITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 794 GRSGAGPLR*LRQLAKGGMCCKAIKLGNARVFP 696 GR+ L + + GMCCK+IKL +A VFP Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKLAHASVFP 40 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 68.5 bits (160), Expect = 1e-11 Identities = 38/67 (56%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = -1 Query: 859 FXKILTLTICHWPFRAXQ-XLGXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRC 683 F ++ H PFR G + R L A KGGCAARRLSWVTPGFSQSRRC Sbjct: 35 FHRLKNQGASHSPFRLRNCGEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRC 91 Query: 682 KTTASEL 662 KTTASEL Sbjct: 92 KTTASEL 98 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 68.1 bits (159), Expect = 2e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 652 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFAS 756 SRITIHWPSFYNVVTGKTLALPNL L+HIP +AS Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYAS 36 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 68.1 bits (159), Expect = 2e-11 Identities = 38/77 (49%), Positives = 46/77 (59%), Gaps = 1/77 (1%) Frame = +3 Query: 612 NSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRS 791 N RG P+ LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ Sbjct: 512 NQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEART 566 Query: 792 AXPN-XCXALNGQWQIV 839 P+ +LNG+W+++ Sbjct: 567 DRPSQQLRSLNGEWRLM 583 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 68.1 bits (159), Expect = 2e-11 Identities = 37/57 (64%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 67.3 bits (157), Expect = 3e-11 Identities = 38/76 (50%), Positives = 46/76 (60%), Gaps = 1/76 (1%) Frame = +3 Query: 615 SRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSA 794 SRG P+ LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTD 871 Query: 795 XPN-XCXALNGQWQIV 839 P+ +LNG+W+++ Sbjct: 872 RPSQQLRSLNGEWRLM 887 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 67.3 bits (157), Expect = 3e-11 Identities = 35/61 (57%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIVSV 845 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLMRQ 1119 Query: 846 N 848 N Sbjct: 1120 N 1120 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 67.3 bits (157), Expect = 3e-11 Identities = 35/68 (51%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIVSV 845 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLMRY 708 Query: 846 NIFXKIXR 869 + + R Sbjct: 709 FLLTHLSR 716 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 67.3 bits (157), Expect = 3e-11 Identities = 38/62 (61%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL*YD 653 H PFR G + R L A KGGCAARRLSWVTPGFSQSRRCKTTASE D Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFSQSRRCKTTASEFPGD 60 Query: 652 SL 647 L Sbjct: 61 PL 62 Score = 64.5 bits (150), Expect = 2e-10 Identities = 34/55 (61%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQW 830 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 67.3 bits (157), Expect = 3e-11 Identities = 33/47 (70%), Positives = 34/47 (72%) Frame = -1 Query: 802 LGXADRVPGLFANYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 662 +G DR G YASWRKG RLSWVTPGFSQSRRCKTTASEL Sbjct: 5 VGKGDRC-GPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 909 KGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 66.5 bits (155), Expect = 5e-11 Identities = 35/65 (53%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIVSV 845 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLMRR 156 Query: 846 NIFXK 860 + K Sbjct: 157 QVRAK 161 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 21 KGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 245 KGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 66.5 bits (155), Expect = 5e-11 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = +3 Query: 612 NSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRS 791 ++RG P+ LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ Sbjct: 79 STRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEART 133 Query: 792 AXPN-XCXALNGQWQIV 839 P+ +LNG+W+++ Sbjct: 134 DRPSQQLRSLNGEWRLM 150 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 378 KGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 288 KGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 KGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 261 KGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 66.5 bits (155), Expect = 5e-11 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = +3 Query: 612 NSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRS 791 ++RG P+ LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ Sbjct: 38 SNRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEART 92 Query: 792 AXPN-XCXALNGQWQIV 839 P+ +LNG+W+++ Sbjct: 93 DRPSQQLRSLNGEWRLM 109 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 139 KGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 66.5 bits (155), Expect = 5e-11 Identities = 37/77 (48%), Positives = 46/77 (59%), Gaps = 1/77 (1%) Frame = +3 Query: 612 NSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRS 791 N +G P+ LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ Sbjct: 187 NPKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEART 241 Query: 792 AXPN-XCXALNGQWQIV 839 P+ +LNG+W+++ Sbjct: 242 DRPSQQLRSLNGEWRLM 258 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 348 KGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 214 KGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 242 KGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 103 KGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 411 KGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 66.5 bits (155), Expect = 5e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 748 KGGCAARRLSWVTPGFSQSRRCKTTASEL 662 KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 79 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 103 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 82 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 168 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 93 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 65 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 142 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 186 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 207 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 114 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 267 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 102 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 129 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 82 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 200 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 113 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 142 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 154 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 31.1 bits (67), Expect = 2.4 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -1 Query: 829 HWPFRAXQXL-GXADRVPGLFANYASWRKGGCAARRLSW 716 H PFR G + R L A KGGCAARRLSW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLA---KGGCAARRLSW 439 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 179 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 115 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 138 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 138 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 138 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 119 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 78 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 162 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 78 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 97 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 130 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 121 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 145 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 95 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 188 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 236 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 224 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 113 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 200 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 170 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 77 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 93 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 215 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 124 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 114 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 125 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 133 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 239 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 498 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 320 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 115 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 124 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 158 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 117 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 128 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 137 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 230 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 137 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 103 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 196 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 122 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 123 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 92 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 98 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 135 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 245 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 141 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 158 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 92 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 104 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 103 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 180 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 97 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 123 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 108 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 142 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 148 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 119 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 221 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 133 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 159 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 100 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 173 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 206 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 156 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 110 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 210 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 123 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 180 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 143 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 125 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 139 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 98 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 147 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 199 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 845 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 126 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 147 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 161 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 135 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 162 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 360 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 84 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 106 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 69 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 107 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.1 bits (154), Expect = 7e-11 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +1 Query: 652 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRN*RRGPAPDRP 795 SRITIHWPSFYNVVTGKTL++ L L PPFASWRN DRP Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRN-SEEARTDRP 48 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 110 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 301 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 66.1 bits (154), Expect = 7e-11 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 669 LAVVLQRRDWENPGVTQLNRLAAHPPFRQLA*LAKRPGTRSAXPN-XCXALNGQWQIV 839 LAVVLQRRDWENPGVTQLNRLAAHPPF A R+ P+ +LNG+W+++ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPF---ASWRNSEEARTDRPSQQLRSLNGEWRLM 135 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,430,383 Number of Sequences: 59808 Number of extensions: 479054 Number of successful extensions: 7900 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5308 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4800750793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -