BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_D01_e100_07.seq (1458 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 232 5e-61 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.3 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 232 bits (568), Expect = 5e-61 Identities = 109/151 (72%), Positives = 127/151 (84%) Frame = +1 Query: 208 QLLDEYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMRKAIKDHLETNPALEKL 387 Q LDEYPK F+VG DNVGS+QMQ IR SLRG VLMGKNTM+RKAI+ HLE NP LEKL Sbjct: 1 QYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIRGHLENNPDLEKL 60 Query: 388 LPHIKGNVGFVFTRGDLVDVRDKLLENKVQAPARPGAIAPLSVVIPAHNTGLGPEKTSFF 567 LPHIKGN+GFVFT+ DL DVR ++ENKV APA+ G IAP+ V +PA NTGLGPEKTSFF Sbjct: 61 LPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNTGLGPEKTSFF 120 Query: 568 QALSIPTKISKGTIEIINDVHILKPGDKVGA 660 QAL+IPTKI++GTIEIINDVH++K +K+ A Sbjct: 121 QALAIPTKIARGTIEIINDVHLIKKDEKLKA 151 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 29.9 bits (64), Expect = 5.3 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = +1 Query: 463 ENKVQAPARPGAIAPLSVVIPAHN--TGLGPEKTSFFQALSIPTKISKGTIEIINDVHIL 636 E ++ +PA +P S+ TGL P S Q LS+ T + ++ D+ Sbjct: 2069 EPRIVSPAGSSLASPTSIATSVITGVTGLHPVTVSHHQPLSVITSLVSASVSSTTDMQNS 2128 Query: 637 KPGDK 651 PG K Sbjct: 2129 TPGKK 2133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,734,156 Number of Sequences: 59808 Number of extensions: 712824 Number of successful extensions: 1631 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1630 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4695110800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -