BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_C10_e171_06.seq (1493 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 31 0.022 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 27 0.47 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 5.8 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 7.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 31.1 bits (67), Expect = 0.022 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 50 KYLHSARILHRDIKPGNLLVNSNCVLKICDXWFGASR 160 ++L R++HRD+ N+LV N +K+ D FG SR Sbjct: 606 EHLAKTRVVHRDLAARNVLVCENHTVKVSD--FGLSR 640 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 26.6 bits (56), Expect = 0.47 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +3 Query: 183 MTQEVVTQYYRAPEILMGANHYTAAVDVWSVGCIFGELLGRRILFQAQSPVQQLELI 353 M EV+ Y+ G + V +++VG ++ RRI +Q +SP+ +L I Sbjct: 1 MDLEVLEIYFTVANKFSGKLWPISIVLIYTVGVVYS--FKRRIFYQDESPISRLVYI 55 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 301 PSSSPKMQPTDHTSTA 254 PSS+P PT TST+ Sbjct: 77 PSSTPSSLPTQRTSTS 92 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 22.6 bits (46), Expect = 7.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 458 AVHALSAGDSRGRSSTRTD 514 A+H S D RGRS T T+ Sbjct: 318 AIHQGSVTDERGRSITLTE 336 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,587 Number of Sequences: 336 Number of extensions: 3013 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 44759725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -