BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_C08_e155_06.seq (1504 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 4.4 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 23 7.8 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.4 bits (48), Expect = 4.4 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -1 Query: 769 VLRXRXMFLIXAQXLX---PGCTRGTAPVXLCAVFLTTL 662 VL +FL+ G + GT V LCA+++TTL Sbjct: 255 VLNLTDLFLVYGMSKSRNIEGVSFGTNLVILCALWITTL 293 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 22.6 bits (46), Expect = 7.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 230 QGDRKGAVKLLEESEFRYRPGVVGALCTLLCA 325 +GDR + LL + + +RPG G L T+ A Sbjct: 147 EGDRANFITLLSDLKEAFRPG--GYLLTVAVA 176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,867 Number of Sequences: 336 Number of extensions: 2590 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45067000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -