BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030712_C08_e155_06.seq
(1504 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 25 7.5
>AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease
protein.
Length = 364
Score = 24.6 bits (51), Expect = 7.5
Identities = 15/57 (26%), Positives = 23/57 (40%)
Frame = -2
Query: 282 YLNSLSSRSLTAPLRSPCERRTCAAASTRVPPCLSKRETDCIFFPSFAREDASTSAA 112
YL++L L P+R C + P C +++ D I+F A AA
Sbjct: 66 YLDTLKCGDLMVPMRKKPIPLLCCPKFSNSPTCGAQQLADRIYFGEETERGAHPWAA 122
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 785,934
Number of Sequences: 2352
Number of extensions: 10549
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 563,979
effective HSP length: 67
effective length of database: 406,395
effective search space used: 175969035
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -