BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_C04_e123_06.seq (1456 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 3.8 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 23 8.7 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.8 bits (49), Expect = 3.8 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +3 Query: 465 PKQSQSTPMTPIHSGNEVVDNTIATLATGWSMFTSSVSKAARTATENAVRYGGIASQK-V 641 PK+S + M G + N + T +G S+F ++ + +RY + SQ V Sbjct: 432 PKKSDMSNMQSDDGGPLSLKNKVETTHSGTSLFRINLGIECGYEIKKLLRYKLLISQNAV 491 Query: 642 SEM 650 SE+ Sbjct: 492 SEL 494 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 483 TPMTPIHSGNEVVDNTIATLATGWSMFTSSVSKAARTATE 602 T TP+ N+ V T A W M ++ + ATE Sbjct: 96 TGSTPLTFVNDTVSFTTTVSARFWLMDCRNIGAVPKMATE 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 288,061 Number of Sequences: 438 Number of extensions: 5256 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 50601375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -