BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_C03_e115_05.seq (1496 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 26 0.83 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 25.8 bits (54), Expect = 0.83 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +1 Query: 163 QHLVGEIVFGVAHIFASFNDTFVHVTDLSGRETI 264 +H+VG IV V ++ SFN T +V D RE I Sbjct: 21 EHMVGTIVVVVRGVWVSFNQTAQNV-DTFVREQI 53 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,364 Number of Sequences: 336 Number of extensions: 4401 Number of successful extensions: 5 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 44862150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -