BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_C03_e115_05.seq (1496 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37595| Best HMM Match : Ribosomal_S11 (HMM E-Value=0) 158 9e-39 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 46 6e-05 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-04 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 45 1e-04 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 44 4e-04 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 4e-04 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 41 0.003 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_20259| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 40 0.005 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 40 0.005 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 40 0.005 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 40 0.005 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 40 0.005 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 40 0.005 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 40 0.005 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 40 0.005 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 40 0.005 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 40 0.005 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 40 0.005 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 40 0.005 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 40 0.005 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 40 0.005 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 40 0.005 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 40 0.005 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 40 0.005 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 40 0.005 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 40 0.005 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 40 0.005 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 40 0.005 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 40 0.005 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 40 0.005 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 40 0.005 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 40 0.005 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 40 0.005 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 40 0.005 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 40 0.005 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 40 0.005 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 40 0.005 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 40 0.005 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 40 0.005 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 40 0.005 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 40 0.005 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 40 0.005 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 40 0.005 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 40 0.005 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 40 0.005 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 40 0.005 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 40 0.005 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 40 0.005 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 40 0.005 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 40 0.005 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 40 0.005 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 40 0.005 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 40 0.005 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 40 0.005 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 40 0.005 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 40 0.005 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 40 0.005 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 40 0.005 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 40 0.005 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 40 0.005 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 40 0.005 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 40 0.005 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 40 0.005 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 40 0.005 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 40 0.005 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 40 0.005 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 40 0.005 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 40 0.005 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 40 0.005 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 40 0.005 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 40 0.005 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 40 0.005 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 40 0.005 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 40 0.005 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 40 0.005 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 40 0.005 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 40 0.005 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 40 0.005 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 40 0.005 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 40 0.005 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 >SB_37595| Best HMM Match : Ribosomal_S11 (HMM E-Value=0) Length = 543 Score = 158 bits (384), Expect = 9e-39 Identities = 81/114 (71%), Positives = 87/114 (76%), Gaps = 1/114 (0%) Frame = +1 Query: 154 LGPQHL-VGEIVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAM 330 LG +H+ GE+VFGVAHIFASFNDTFVHVTDLSGRETI+RVTGGMKVKADRDEASPYAAM Sbjct: 187 LGWRHVGEGELVFGVAHIFASFNDTFVHVTDLSGRETISRVTGGMKVKADRDEASPYAAM 246 Query: 331 LAAQDVAEKCKTLGITALHIKLRAXXXXXXXXXXXXAQXXXXXXXXXXMKIGRI 492 LAAQDVA +CK +GITALHIKLRA AQ MKIGRI Sbjct: 247 LAAQDVAARCKEIGITALHIKLRATGGNKTKTPGPGAQSALRALARSGMKIGRI 300 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 52.4 bits (120), Expect = 9e-07 Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +1 Query: 673 LEGGPGTQFAL*XVVFNFT--WPSFYXVGDWENPGVXQLXRXAXIPPFXXW 819 + G + A+ +V T WPSFY DWENPGV QL R A PPF W Sbjct: 8 IAAGIAVELAIRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASW 58 Score = 32.7 bits (71), Expect = 0.78 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +3 Query: 696 IRPIXSRIQFHLAVVLXRRXLGKPWRXPTXSXCXNSPFXXXAXXQXAXPDRPFQQ 860 IRPI SRI H RR P + PF + A DRP QQ Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPSQQ 72 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 2e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +1 Query: 730 WPSFYXVGDWENPGVXQLXRXAXIPPFXXW 819 WPSFY V WENPGV QL R A PPF W Sbjct: 8 WPSFYNVVHWENPGVTQLNRLAAHPPFASW 37 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 46.4 bits (105), Expect = 6e-05 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 819 PXGERGNXCXAXKLGNARVFPVXDXVKRRP 730 P GERG C A KLGNA VFP D VKRRP Sbjct: 12 PAGERGMCCKAIKLGNASVFPSHDVVKRRP 41 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 46.4 bits (105), Expect = 6e-05 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 819 PXGERGNXCXAXKLGNARVFPVXDXVKRRP 730 P GERG C A KLGNA VFP D VKRRP Sbjct: 26 PAGERGMCCKAIKLGNASVFPSHDVVKRRP 55 Score = 31.1 bits (67), Expect = 2.4 Identities = 19/56 (33%), Positives = 22/56 (39%) Frame = -1 Query: 860 LLERAIGXGLLVXSXXXKGGIXAXRXSWXTPGFSQSPTX*NDGQVKLNTTXYRANW 693 LL RAIG GL + + G+ S V NTT YRANW Sbjct: 12 LLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 45.6 bits (103), Expect = 1e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +1 Query: 730 WPSFYXVGDWENPGVXQLXRXAXIPPFXXW 819 WPS DWENPGV QL R A PPF W Sbjct: 284 WPSVLQRRDWENPGVTQLNRLAAHPPFASW 313 Score = 29.1 bits (62), Expect = 9.6 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +3 Query: 711 SRIQFHLAVVLXRRXLGKPWRXPTXSXCXNSPFXXXAXXQXAXPDRPFQQ 860 SRI H VL RR P + PF + A DRP QQ Sbjct: 278 SRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 327 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 45.2 bits (102), Expect = 1e-04 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXWLXTXRPXPIALSNN 861 DWENPGV QL R A PPF WL P + L+ + Sbjct: 150 DWENPGVTQLNRLAAHPPFASWLENLSPLTVNLTGS 185 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -3 Query: 819 PXGERGNXCXAXKLGNARVFPVXDXVKRRP 730 P GERG C A KLGNA+ FP D VKRRP Sbjct: 18 PAGERGMCCKAIKLGNAKGFPSHDVVKRRP 47 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = +1 Query: 730 WPSFYXVGDWENPGVXQLXRXAXIPPFXXW 819 WPSFY V +NPGV QL R A PPF W Sbjct: 8 WPSFYNVVTGKNPGVTQLNRLAAHPPFASW 37 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 43.6 bits (98), Expect = 4e-04 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXWLXTXRP 837 DWENPGV QL R A PPF W + RP Sbjct: 352 DWENPGVTQLNRLAAHPPFASWRNSERP 379 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 43.6 bits (98), Expect = 4e-04 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 819 PXGERGNXCXAXKLGNARVFPVXDXVKRRP 730 P GERG C A KLGNAR FP D KRRP Sbjct: 57 PAGERGMCCKAIKLGNARGFPSHDGEKRRP 86 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/64 (39%), Positives = 27/64 (42%) Frame = +2 Query: 695 NSPYXESYSISLGRRFTXSXTGKTLAXPNLXALXXFPLSPXGXXXXXXXXXXXXXXXXXL 874 NSPY +I F TGKTLA PNL AL PLSP G L Sbjct: 75 NSPYMSRITIHWPS-FYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSL 133 Query: 875 NXKW 886 N +W Sbjct: 134 NGEW 137 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.5 bits (93), Expect = 0.002 Identities = 21/42 (50%), Positives = 23/42 (54%) Frame = +1 Query: 694 QFAL*XVVFNFTWPSFYXVGDWENPGVXQLXRXAXIPPFXXW 819 QFAL +N + F DWENPGV QL R A PPF W Sbjct: 54 QFALYESYYN-SLAVFLQRRDWENPGVTQLNRLAAHPPFASW 94 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +1 Query: 730 WPSFYXVGDWENPGVXQLXRXAXIPPFXXW 819 WPSFY V +N GV QL R A PPF W Sbjct: 8 WPSFYNVVTGKNTGVTQLNRLAAHPPFASW 37 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 809 KGGIXAXRXSWXTPGFSQSPTX*NDGQVKLNTTXYRANW 693 KGG A R SW TPGF V NTT YRANW Sbjct: 43 KGGCAARRLSWVTPGFPSHDVV-KRRPVNCNTTHYRANW 80 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +1 Query: 730 WPSFYXVGDWENPGVXQLXRXAXIPPFXXW 819 WPSFY V +N GV QL R A PPF W Sbjct: 8 WPSFYNVVTGKNTGVTQLNRLAAHPPFASW 37 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 40.7 bits (91), Expect = 0.003 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = -3 Query: 819 PXGERGNXCXAXKLGNARVFPVXDXVKRRP 730 P GERG C + KL +A VFP D VKRRP Sbjct: 20 PAGERGMCCKSIKLAHASVFPSHDVVKRRP 49 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/56 (33%), Positives = 22/56 (39%) Frame = -1 Query: 860 LLERAIGXGLLVXSXXXKGGIXAXRXSWXTPGFSQSPTX*NDGQVKLNTTXYRANW 693 LL RAIG GL + + G+ S V NTT YRANW Sbjct: 6 LLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXWLXT 828 DWENPGV QL R A PPF W T Sbjct: 67 DWENPGVTQLNRLAAHPPFASWRNT 91 >SB_20259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.7 bits (91), Expect = 0.003 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 16 DWENPGVTQLNRLAAYPPFASW 37 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXWLXT 828 DWENPGV QL R A PPF W T Sbjct: 75 DWENPGVTQLNRLAAHPPFASWRNT 99 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +1 Query: 730 WPSFYXVGDWENPGVXQLXRXAXIPPFXXW 819 WPSFY V + PGV QL R A PPF W Sbjct: 8 WPSFYNVMLAKTPGVTQLNRLAAHPPFASW 37 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 43 DWENPGVTQLNRLAAHPPFASW 64 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 23 DWENPGVTQLNRLAAHPPFASW 44 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 70 DWENPGVTQLNRLAAHPPFASW 91 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 52 DWENPGVTQLNRLAAHPPFASW 73 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 44 DWENPGVTQLNRLAAHPPFASW 65 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 70 DWENPGVTQLNRLAAHPPFASW 91 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 75 DWENPGVTQLNRLAAHPPFASW 96 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 46 DWENPGVTQLNRLAAHPPFASW 67 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 66 DWENPGVTQLNRLAAHPPFASW 87 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 78 DWENPGVTQLNRLAAHPPFASW 99 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 54 DWENPGVTQLNRLAAHPPFASW 75 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 43 DWENPGVTQLNRLAAHPPFASW 64 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 33 DWENPGVTQLNRLAAHPPFASW 54 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 58 DWENPGVTQLNRLAAHPPFASW 79 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 67 DWENPGVTQLNRLAAHPPFASW 88 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 61 DWENPGVTQLNRLAAHPPFASW 82 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 77 DWENPGVTQLNRLAAHPPFASW 98 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 65 DWENPGVTQLNRLAAHPPFASW 86 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 48 DWENPGVTQLNRLAAHPPFASW 69 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 48 DWENPGVTQLNRLAAHPPFASW 69 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 224 DWENPGVTQLNRLAAHPPFASW 245 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 119 DWENPGVTQLNRLAAHPPFASW 140 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 57 DWENPGVTQLNRLAAHPPFASW 78 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 36 DWENPGVTQLNRLAAHPPFASW 57 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 24 DWENPGVTQLNRLAAHPPFASW 45 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 55 DWENPGVTQLNRLAAHPPFASW 76 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 389 DWENPGVTQLNRLAAHPPFASW 410 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 115 DWENPGVTQLNRLAAHPPFASW 136 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 91 DWENPGVTQLNRLAAHPPFASW 112 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 47 DWENPGVTQLNRLAAHPPFASW 68 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 16 DWENPGVTQLNRLAAHPPFASW 37 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 26 DWENPGVTQLNRLAAHPPFASW 47 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 46 DWENPGVTQLNRLAAHPPFASW 67 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 111 DWENPGVTQLNRLAAHPPFASW 132 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 53 DWENPGVTQLNRLAAHPPFASW 74 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 348 DWENPGVTQLNRLAAHPPFASW 369 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 88 DWENPGVTQLNRLAAHPPFASW 109 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 58 DWENPGVTQLNRLAAHPPFASW 79 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 24 DWENPGVTQLNRLAAHPPFASW 45 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 67 DWENPGVTQLNRLAAHPPFASW 88 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 51 DWENPGVTQLNRLAAHPPFASW 72 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 142 DWENPGVTQLNRLAAHPPFASW 163 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 71 DWENPGVTQLNRLAAHPPFASW 92 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 47 DWENPGVTQLNRLAAHPPFASW 68 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 151 DWENPGVTQLNRLAAHPPFASW 172 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 841 DWENPGVTQLNRLAAHPPFASW 862 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 24 DWENPGVTQLNRLAAHPPFASW 45 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 68 DWENPGVTQLNRLAAHPPFASW 89 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 42 DWENPGVTQLNRLAAHPPFASW 63 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 81 DWENPGVTQLNRLAAHPPFASW 102 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 75 DWENPGVTQLNRLAAHPPFASW 96 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 64 DWENPGVTQLNRLAAHPPFASW 85 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 77 DWENPGVTQLNRLAAHPPFASW 98 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 73 DWENPGVTQLNRLAAHPPFASW 94 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 264 DWENPGVTQLNRLAAHPPFASW 285 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 122 DWENPGVTQLNRLAAHPPFASW 143 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 58 DWENPGVTQLNRLAAHPPFASW 79 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 44 DWENPGVTQLNRLAAHPPFASW 65 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 45 DWENPGVTQLNRLAAHPPFASW 66 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 109 DWENPGVTQLNRLAAHPPFASW 130 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 122 DWENPGVTQLNRLAAHPPFASW 143 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 47 DWENPGVTQLNRLAAHPPFASW 68 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 28 DWENPGVTQLNRLAAHPPFASW 49 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 66 DWENPGVTQLNRLAAHPPFASW 87 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 45 DWENPGVTQLNRLAAHPPFASW 66 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 42 DWENPGVTQLNRLAAHPPFASW 63 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 19 DWENPGVTQLNRLAAHPPFASW 40 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 27 DWENPGVTQLNRLAAHPPFASW 48 Score = 29.1 bits (62), Expect = 9.6 Identities = 19/62 (30%), Positives = 22/62 (35%) Frame = +3 Query: 675 RGGARYPIRPIXSRIQFHLAVVLXRRXLGKPWRXPTXSXCXNSPFXXXAXXQXAXPDRPF 854 RG P+ LAVVL RR P + PF + A DRP Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 60 Query: 855 QQ 860 QQ Sbjct: 61 QQ 62 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 404 DWENPGVTQLNRLAAHPPFASW 425 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 53 DWENPGVTQLNRLAAHPPFASW 74 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 62 DWENPGVTQLNRLAAHPPFASW 83 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 44 DWENPGVTQLNRLAAHPPFASW 65 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 127 DWENPGVTQLNRLAAHPPFASW 148 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 63 DWENPGVTQLNRLAAHPPFASW 84 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 73 DWENPGVTQLNRLAAHPPFASW 94 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 76 DWENPGVTQLNRLAAHPPFASW 97 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 422 DWENPGVTQLNRLAAHPPFASW 443 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 119 DWENPGVTQLNRLAAHPPFASW 140 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 75 DWENPGVTQLNRLAAHPPFASW 96 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 64 DWENPGVTQLNRLAAHPPFASW 85 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 54 DWENPGVTQLNRLAAHPPFASW 75 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 57 DWENPGVTQLNRLAAHPPFASW 78 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 169 DWENPGVTQLNRLAAHPPFASW 190 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 73 DWENPGVTQLNRLAAHPPFASW 94 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 60 DWENPGVTQLNRLAAHPPFASW 81 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 96 DWENPGVTQLNRLAAHPPFASW 117 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 45 DWENPGVTQLNRLAAHPPFASW 66 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 71 DWENPGVTQLNRLAAHPPFASW 92 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 50 DWENPGVTQLNRLAAHPPFASW 71 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 193 DWENPGVTQLNRLAAHPPFASW 214 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 42 DWENPGVTQLNRLAAHPPFASW 63 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 48 DWENPGVTQLNRLAAHPPFASW 69 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 62 DWENPGVTQLNRLAAHPPFASW 83 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 59 DWENPGVTQLNRLAAHPPFASW 80 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 42 DWENPGVTQLNRLAAHPPFASW 63 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 43 DWENPGVTQLNRLAAHPPFASW 64 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 57 DWENPGVTQLNRLAAHPPFASW 78 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 47 DWENPGVTQLNRLAAHPPFASW 68 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 140 DWENPGVTQLNRLAAHPPFASW 161 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 49 DWENPGVTQLNRLAAHPPFASW 70 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 92 DWENPGVTQLNRLAAHPPFASW 113 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 30 DWENPGVTQLNRLAAHPPFASW 51 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 161 DWENPGVTQLNRLAAHPPFASW 182 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 348 DWENPGVTQLNRLAAHPPFASW 369 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 65 DWENPGVTQLNRLAAHPPFASW 86 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 29 DWENPGVTQLNRLAAHPPFASW 50 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 55 DWENPGVTQLNRLAAHPPFASW 76 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 117 DWENPGVTQLNRLAAHPPFASW 138 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 94 DWENPGVTQLNRLAAHPPFASW 115 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 44 DWENPGVTQLNRLAAHPPFASW 65 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 68 DWENPGVTQLNRLAAHPPFASW 89 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 302 DWENPGVTQLNRLAAHPPFASW 323 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 65 DWENPGVTQLNRLAAHPPFASW 86 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 66 DWENPGVTQLNRLAAHPPFASW 87 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 24 DWENPGVTQLNRLAAHPPFASW 45 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 44 DWENPGVTQLNRLAAHPPFASW 65 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 419 DWENPGVTQLNRLAAHPPFASW 440 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 103 DWENPGVTQLNRLAAHPPFASW 124 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 59 DWENPGVTQLNRLAAHPPFASW 80 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 51 DWENPGVTQLNRLAAHPPFASW 72 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 101 DWENPGVTQLNRLAAHPPFASW 122 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 51 DWENPGVTQLNRLAAHPPFASW 72 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 219 DWENPGVTQLNRLAAHPPFASW 240 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 51 DWENPGVTQLNRLAAHPPFASW 72 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 221 DWENPGVTQLNRLAAHPPFASW 242 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 41 DWENPGVTQLNRLAAHPPFASW 62 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 56 DWENPGVTQLNRLAAHPPFASW 77 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 46 DWENPGVTQLNRLAAHPPFASW 67 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 51 DWENPGVTQLNRLAAHPPFASW 72 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 155 DWENPGVTQLNRLAAHPPFASW 176 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 53 DWENPGVTQLNRLAAHPPFASW 74 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 43 DWENPGVTQLNRLAAHPPFASW 64 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 63 DWENPGVTQLNRLAAHPPFASW 84 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 48 DWENPGVTQLNRLAAHPPFASW 69 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 83 DWENPGVTQLNRLAAHPPFASW 104 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 203 DWENPGVTQLNRLAAHPPFASW 224 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 61 DWENPGVTQLNRLAAHPPFASW 82 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 40 DWENPGVTQLNRLAAHPPFASW 61 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 94 DWENPGVTQLNRLAAHPPFASW 115 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 30 DWENPGVTQLNRLAAHPPFASW 51 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 57 DWENPGVTQLNRLAAHPPFASW 78 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 195 DWENPGVTQLNRLAAHPPFASW 216 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 65 DWENPGVTQLNRLAAHPPFASW 86 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 75 DWENPGVTQLNRLAAHPPFASW 96 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 58 DWENPGVTQLNRLAAHPPFASW 79 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 65 DWENPGVTQLNRLAAHPPFASW 86 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 108 DWENPGVTQLNRLAAHPPFASW 129 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 84 DWENPGVTQLNRLAAHPPFASW 105 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 104 DWENPGVTQLNRLAAHPPFASW 125 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 81 DWENPGVTQLNRLAAHPPFASW 102 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 48 DWENPGVTQLNRLAAHPPFASW 69 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 57 DWENPGVTQLNRLAAHPPFASW 78 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 671 DWENPGVTQLNRLAAHPPFASW 692 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 56 DWENPGVTQLNRLAAHPPFASW 77 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 45 DWENPGVTQLNRLAAHPPFASW 66 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 36 DWENPGVTQLNRLAAHPPFASW 57 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 154 DWENPGVTQLNRLAAHPPFASW 175 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 46 DWENPGVTQLNRLAAHPPFASW 67 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 67 DWENPGVTQLNRLAAHPPFASW 88 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 96 DWENPGVTQLNRLAAHPPFASW 117 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 44 DWENPGVTQLNRLAAHPPFASW 65 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 108 DWENPGVTQLNRLAAHPPFASW 129 Score = 29.1 bits (62), Expect = 9.6 Identities = 20/62 (32%), Positives = 23/62 (37%) Frame = +3 Query: 675 RGGARYPIRPIXSRIQFHLAVVLXRRXLGKPWRXPTXSXCXNSPFXXXAXXQXAXPDRPF 854 RGG P+ LAVVL RR P + PF + A DRP Sbjct: 84 RGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 141 Query: 855 QQ 860 QQ Sbjct: 142 QQ 143 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 51 DWENPGVTQLNRLAAHPPFASW 72 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 1198 DWENPGVTQLNRLAAHPPFASW 1219 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 50 DWENPGVTQLNRLAAHPPFASW 71 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 40 DWENPGVTQLNRLAAHPPFASW 61 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 133 DWENPGVTQLNRLAAHPPFASW 154 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 64 DWENPGVTQLNRLAAHPPFASW 85 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 85 DWENPGVTQLNRLAAHPPFASW 106 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 58 DWENPGVTQLNRLAAHPPFASW 79 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 134 DWENPGVTQLNRLAAHPPFASW 155 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 176 DWENPGVTQLNRLAAHPPFASW 197 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 39 DWENPGVTQLNRLAAHPPFASW 60 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 88 DWENPGVTQLNRLAAHPPFASW 109 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 38 DWENPGVTQLNRLAAHPPFASW 59 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 53 DWENPGVTQLNRLAAHPPFASW 74 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 24 DWENPGVTQLNRLAAHPPFASW 45 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 83 DWENPGVTQLNRLAAHPPFASW 104 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 933 DWENPGVTQLNRLAAHPPFASW 954 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 42 DWENPGVTQLNRLAAHPPFASW 63 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 44 DWENPGVTQLNRLAAHPPFASW 65 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 54 DWENPGVTQLNRLAAHPPFASW 75 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 44 DWENPGVTQLNRLAAHPPFASW 65 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 104 DWENPGVTQLNRLAAHPPFASW 125 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 361 DWENPGVTQLNRLAAHPPFASW 382 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 91 DWENPGVTQLNRLAAHPPFASW 112 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 73 DWENPGVTQLNRLAAHPPFASW 94 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 83 DWENPGVTQLNRLAAHPPFASW 104 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 37 DWENPGVTQLNRLAAHPPFASW 58 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 16 DWENPGVTQLNRLAAHPPFASW 37 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 69 DWENPGVTQLNRLAAHPPFASW 90 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 754 DWENPGVXQLXRXAXIPPFXXW 819 DWENPGV QL R A PPF W Sbjct: 92 DWENPGVTQLNRLAAHPPFASW 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,919,606 Number of Sequences: 59808 Number of extensions: 578538 Number of successful extensions: 8688 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8344 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4847701901 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -