BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_C03_e115_05.seq (1496 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 25 4.3 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 7.5 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 7.5 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 7.5 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 9.9 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 25.4 bits (53), Expect = 4.3 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -1 Query: 284 MPPVTRAIVSRPDRSVTCTN----VSLKEANMCA 195 +PPV R RP ++ TCT V L E N A Sbjct: 384 LPPVPRCDEQRPHKATTCTEGKSLVPLMERNSTA 417 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 7.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 520 SQTAQGSHLQCGQSSCWNEREHGEQTGHQVQ 428 S+ + +H S W R HGE T H Q Sbjct: 955 SRYTRWTHRIIRDISAWQGRRHGEMTFHLAQ 985 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 7.5 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 397 GA*CAGQLSPGFYISQQHPVQPT*RRRVKPHHDQP--SLSCL 278 GA AG ++ G P +PT R VKP D+P +L CL Sbjct: 55 GATGAGAINIGGTTIPIAPKKPTRRAGVKPQPDRPMRALFCL 96 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.6 bits (51), Expect = 7.5 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -2 Query: 520 SQTAQGSHLQCGQSSCWNEREHGEQTGHQVQESLSCYLQSHG 395 S+ + +HL W R HGE T H LS L HG Sbjct: 903 SRYVRWAHLVIPDVGAWQLRNHGEVTFH-----LSQVLSGHG 939 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 24.2 bits (50), Expect = 9.9 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 Query: 291 HFHASGNTGNSFSTGQIGNVHECVIEG 211 H H + GN G GN H+ + +G Sbjct: 128 HHHGNNGGGNGGGGGSGGNAHDHLADG 154 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,066,096 Number of Sequences: 2352 Number of extensions: 19984 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 175156245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -