BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_C01_e099_05.seq (1438 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0234 + 15187065-15188241,15188316-15188494 45 1e-04 04_03_0649 - 18402976-18403220,18403305-18404499 38 0.019 08_01_0192 + 1594530-1594682,1594755-1594955,1595051-1595280,159... 30 3.9 05_03_0086 + 8279518-8280320,8280923-8281844 30 3.9 10_08_0009 + 14075929-14076789 29 9.0 03_02_0517 + 9054816-9055655 29 9.0 >11_04_0234 + 15187065-15188241,15188316-15188494 Length = 451 Score = 45.2 bits (102), Expect = 1e-04 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 2/105 (1%) Frame = +3 Query: 294 SFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHANYRAITNLKRQFPQLRVFLTVGGDDD 473 S +HL Y S I +T V+ + + +N+ + ++ L++G D+ Sbjct: 62 SLYSHLYYSSLSID-ETRCAVAPPSSGEESSILSNFSSSIKSSGGGFAVKTILSIGTDEF 120 Query: 474 TEDPQK--YNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLP 602 ED ++ + R AF NS++ LA GFDG+DL+W+ P Sbjct: 121 REDVSNAAFSRMASEKNLRRAFINSSIELARANGFDGLDLAWRFP 165 >04_03_0649 - 18402976-18403220,18403305-18404499 Length = 479 Score = 37.9 bits (84), Expect = 0.019 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +3 Query: 480 DPQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLP 602 DP + + P +R AF +A+ +A + GFDG+D++W+ P Sbjct: 131 DPA-FAAMAADPASRAAFIGAAVKVARENGFDGLDVAWRFP 170 >08_01_0192 + 1594530-1594682,1594755-1594955,1595051-1595280, 1595596-1595766,1595902-1596007,1596339-1596545, 1596638-1596802 Length = 410 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 Query: 534 TNSALLLAEQYGFDGIDLSWQLPKRKPKKIRSSIGSFW 647 T +L+ E + FD L+W + R P +I++++ +W Sbjct: 339 TKKMILVGEVFRFDLDTLTWSVIGRMPFRIKTALAGYW 376 >05_03_0086 + 8279518-8280320,8280923-8281844 Length = 574 Score = 30.3 bits (65), Expect = 3.9 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +3 Query: 498 LLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLPKR-KPKKIRSSIGSFWHSIKKTFGT 674 LL++ P R AFT A + + FDG+ +W L + P + + F T Sbjct: 478 LLVKEPHKRIAFTRGATEIKQHPFFDGV--NWALVRSLTPPSVPEPV-DFRQYAAAASAT 534 Query: 675 TPVDDKESEH 704 TP D K E+ Sbjct: 535 TPKDKKPPEN 544 >10_08_0009 + 14075929-14076789 Length = 286 Score = 29.1 bits (62), Expect = 9.0 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 4/76 (5%) Frame = +3 Query: 381 DRAHANYRAITNLKRQFPQLRVFLTVGGDDDTEDPQKYNLLLESPQARTAFTNSALL--- 551 D A+ + A+ K P L V L +GGD T N + A+ +A Sbjct: 62 DTANLSPAAVAAAKAAHPNLSVILALGGD--TVQNTGVNATFAPTSSVDAWVRNAADSVS 119 Query: 552 -LAEQYGFDGIDLSWQ 596 L + YG DG+D+ ++ Sbjct: 120 GLIDAYGLDGVDVDYE 135 >03_02_0517 + 9054816-9055655 Length = 279 Score = 29.1 bits (62), Expect = 9.0 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 247 ENLKHVCCLRTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWTL 381 +++ H C+ W L S P+C LPA+ + + IW L Sbjct: 154 KHVYHQDCILPWLSLRNSCPVCRRELPAAAAPESEADAGLTIWRL 198 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,426,114 Number of Sequences: 37544 Number of extensions: 503495 Number of successful extensions: 1142 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4559628444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -