Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030712_B09_e162_03.seq
         (1546 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z73425-7|CAA97790.1| 1059|Caenorhabditis elegans Hypothetical pr...    29   6.7  

>Z73425-7|CAA97790.1| 1059|Caenorhabditis elegans Hypothetical
           protein F12F6.5 protein.
          Length = 1059

 Score = 29.5 bits (63), Expect = 6.7
 Identities = 18/65 (27%), Positives = 30/65 (46%)
 Frame = +2

Query: 149 LPVDATXAVLMARLLDEQKKLPQRELDELDRFFLNISDTVKKFTPYLQAVAKNQIFSLVS 328
           L +D     L+ +++DE+KK+ Q E+D L       S    K        A +Q+F L  
Sbjct: 293 LGMDFWLRALLEKVIDERKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPK 352

Query: 329 EMELQ 343
           + E +
Sbjct: 353 QFEFR 357


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,974,702
Number of Sequences: 27780
Number of extensions: 447131
Number of successful extensions: 889
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 844
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 889
length of database: 12,740,198
effective HSP length: 85
effective length of database: 10,378,898
effective search space used: 4452547242
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)