BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030712_B09_e162_03.seq
(1546 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z73425-7|CAA97790.1| 1059|Caenorhabditis elegans Hypothetical pr... 29 6.7
>Z73425-7|CAA97790.1| 1059|Caenorhabditis elegans Hypothetical
protein F12F6.5 protein.
Length = 1059
Score = 29.5 bits (63), Expect = 6.7
Identities = 18/65 (27%), Positives = 30/65 (46%)
Frame = +2
Query: 149 LPVDATXAVLMARLLDEQKKLPQRELDELDRFFLNISDTVKKFTPYLQAVAKNQIFSLVS 328
L +D L+ +++DE+KK+ Q E+D L S K A +Q+F L
Sbjct: 293 LGMDFWLRALLEKVIDERKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPK 352
Query: 329 EMELQ 343
+ E +
Sbjct: 353 QFEFR 357
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,974,702
Number of Sequences: 27780
Number of extensions: 447131
Number of successful extensions: 889
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 844
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 889
length of database: 12,740,198
effective HSP length: 85
effective length of database: 10,378,898
effective search space used: 4452547242
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -