BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_B07_e146_03.seq (1430 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 39 1e-04 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 23 6.5 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 38.7 bits (86), Expect = 1e-04 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +3 Query: 15 LPVAKYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQ 161 + YD+ ++ ++ +AK+ I ++L + R+ AS L HPW+ Q Sbjct: 124 IKTGSYDYPSPEWDTVTPEAKNLINQMLTVNPSKRITASEALKHPWICQ 172 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 267 MGAKFEDVHEECGXKNGE 320 + KF D+ E+C +NG+ Sbjct: 368 IACKFADIKEKCDRRNGK 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,673 Number of Sequences: 438 Number of extensions: 2143 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 60 effective length of database: 120,063 effective search space used: 49946208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -