BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_B07_e146_03.seq (1430 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66210.2 68418.m08341 calcium-dependent protein kinase family... 49 7e-06 At5g66210.1 68418.m08340 calcium-dependent protein kinase family... 49 7e-06 At2g17890.1 68415.m02072 calcium-dependent protein kinase family... 48 1e-05 At2g17290.1 68415.m01997 calcium-dependent protein kinase isofor... 48 2e-05 At4g21940.1 68417.m03174 calcium-dependent protein kinase, putat... 48 2e-05 At4g04740.1 68417.m00695 calcium-dependent protein kinase, putat... 45 1e-04 At1g49580.1 68414.m05559 calcium-dependent protein kinase, putat... 45 1e-04 At4g23650.1 68417.m03405 calcium-dependent protein kinase, putat... 44 2e-04 At4g35310.1 68417.m05019 calcium-dependent protein kinase, putat... 44 2e-04 At3g57530.1 68416.m06406 calcium-dependent protein kinase, putat... 44 2e-04 At3g56760.1 68416.m06313 calcium-dependent protein kinase, putat... 44 2e-04 At3g50530.1 68416.m05526 calcium-dependent protein kinase, putat... 44 2e-04 At3g49370.1 68416.m05397 calcium-dependent protein kinase, putat... 44 2e-04 At5g24430.1 68418.m02879 calcium-dependent protein kinase, putat... 44 3e-04 At5g04870.1 68418.m00510 calcium-dependent protein kinase isofor... 44 3e-04 At4g36070.1 68417.m05135 calcium-dependent protein kinase family... 44 3e-04 At3g19100.1 68416.m02427 calcium-dependent protein kinase, putat... 44 3e-04 At2g46700.1 68415.m05827 calcium-dependent protein kinase, putat... 44 3e-04 At1g50700.1 68414.m05701 calcium-dependent protein kinase, putat... 44 3e-04 At4g04720.1 68417.m00693 calcium-dependent protein kinase, putat... 43 4e-04 At3g10660.1 68416.m01282 calcium-dependent protein kinase isofor... 43 4e-04 At2g41860.2 68415.m05174 calcium-dependent protein kinase, putat... 43 6e-04 At2g41860.1 68415.m05173 calcium-dependent protein kinase, putat... 43 6e-04 At1g76040.2 68414.m08829 calcium-dependent protein kinase, putat... 43 6e-04 At1g76040.1 68414.m08830 calcium-dependent protein kinase, putat... 43 6e-04 At5g12480.1 68418.m01466 calmodulin-domain protein kinase isofor... 42 8e-04 At2g41140.1 68415.m05081 calcium-dependent protein kinase, putat... 42 8e-04 At5g12180.1 68418.m01429 calcium-dependent protein kinase, putat... 42 0.001 At3g20410.1 68416.m02585 calmodulin-domain protein kinase isofor... 42 0.001 At2g45490.1 68415.m05658 protein kinase, putative contains prote... 42 0.001 At1g61950.1 68414.m06988 calcium-dependent protein kinase, putat... 42 0.001 At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDP... 42 0.001 At2g35890.1 68415.m04406 calcium-dependent protein kinase, putat... 42 0.001 At5g19360.1 68418.m02307 calcium-dependent protein kinase, putat... 41 0.002 At4g04710.1 68417.m00692 calcium-dependent protein kinase, putat... 41 0.002 At4g38230.1 68417.m05399 calcium-dependent protein kinase, putat... 41 0.002 At4g32830.1 68417.m04669 protein kinase, putative similar to pro... 41 0.002 At2g31500.1 68415.m03848 calcium-dependent protein kinase, putat... 41 0.002 At2g25880.1 68415.m03106 serine/threonine protein kinase, putati... 41 0.002 At1g08650.1 68414.m00960 phosphoenolpyruvate carboxylase kinase ... 41 0.002 At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDP... 40 0.003 At4g09570.1 68417.m01575 calcium-dependent protein kinase, putat... 40 0.004 At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDP... 40 0.005 At1g12680.1 68414.m01472 protein kinase family protein contains ... 39 0.007 At5g19450.2 68418.m02318 calcium-dependent protein kinase 19 (CD... 39 0.009 At5g19450.1 68418.m02317 calcium-dependent protein kinase 19 (CD... 39 0.009 At2g38910.1 68415.m04783 calcium-dependent protein kinase, putat... 39 0.009 At1g05100.1 68414.m00513 protein kinase family protein contains ... 37 0.028 At3g04530.1 68416.m00480 phosphoenolpyruvate carboxylase kinase ... 35 0.11 At2g23080.1 68415.m02752 casein kinase II alpha chain, putative ... 34 0.26 At1g12580.1 68414.m01461 protein kinase family protein contains ... 33 0.35 At3g50000.1 68416.m05467 casein kinase II alpha chain 2 identica... 33 0.46 At5g67080.1 68418.m08458 protein kinase family protein contains ... 32 0.80 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 32 1.1 At2g32510.1 68415.m03972 protein kinase family protein contains ... 32 1.1 At3g46160.1 68416.m04995 protein kinase-related contains eukaryo... 31 1.4 At3g06030.1 68416.m00688 NPK1-related protein kinase, putative (... 31 1.4 At2g17210.1 68415.m01987 pentatricopeptide (PPR) repeat-containi... 31 1.4 At5g67380.1 68418.m08496 casein kinase II alpha chain 1 identica... 31 1.9 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 31 1.9 At5g10930.1 68418.m01268 CBL-interacting protein kinase 5 (CIPK5... 31 2.5 At4g26890.1 68417.m03869 protein kinase family protein contains ... 30 3.2 At5g22840.1 68418.m02670 protein kinase family protein contains ... 30 4.3 At4g40010.1 68417.m05665 serine/threonine protein kinase, putati... 30 4.3 At1g07150.1 68414.m00761 protein kinase family protein contains ... 30 4.3 At2g30040.1 68415.m03653 protein kinase family protein contains ... 29 7.5 At3g50310.1 68416.m05502 protein kinase-related contains eukaryo... 29 9.9 At3g45240.1 68416.m04882 protein kinase family protein contains ... 29 9.9 At1g54960.1 68414.m06277 NPK1-related protein kinase, putative (... 29 9.9 >At5g66210.2 68418.m08341 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 523 Score = 49.2 bits (112), Expect = 7e-06 Identities = 24/54 (44%), Positives = 33/54 (61%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHV 188 K DF + + ISD AKDF+ KLLVKD RL A+ L+H W+ + T++ V Sbjct: 280 KPDFSRKPWATISDSAKDFVKKLLVKDPRARLTAAQALSHAWVREGGNATDIPV 333 >At5g66210.1 68418.m08340 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 523 Score = 49.2 bits (112), Expect = 7e-06 Identities = 24/54 (44%), Positives = 33/54 (61%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHV 188 K DF + + ISD AKDF+ KLLVKD RL A+ L+H W+ + T++ V Sbjct: 280 KPDFSRKPWATISDSAKDFVKKLLVKDPRARLTAAQALSHAWVREGGNATDIPV 333 >At2g17890.1 68415.m02072 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 571 Score = 48.4 bits (110), Expect = 1e-05 Identities = 23/54 (42%), Positives = 34/54 (62%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHV 188 K DF + + IS+ AKDF+ KLLVKD RL A+ L+HPW+ + +E+ + Sbjct: 326 KPDFRRKPWPTISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPI 379 >At2g17290.1 68415.m01997 calcium-dependent protein kinase isoform 6 (CPK6) identical to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 544 Score = 48.0 bits (109), Expect = 2e-05 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 2/91 (2%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXRY 212 DFD + + ISD AKD I K+L +RL A L HPW+ ++ + + + L R Sbjct: 303 DFDTDPWPVISDSAKDLIRKMLCSSPSERLTAHEVLRHPWICENGVAPDRALDPAVLSR- 361 Query: 213 VIKKRWAKAVSAVIALKRMGAKF--EDVHEE 299 K SA+ LK+M K E + EE Sbjct: 362 ------LKQFSAMNKLKKMALKVIAESLSEE 386 >At4g21940.1 68417.m03174 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423 Length = 554 Score = 47.6 bits (108), Expect = 2e-05 Identities = 19/41 (46%), Positives = 26/41 (63%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 DFD + + IS+ AKD + KLL KD R+ A+ L HPW+ Sbjct: 320 DFDSQPWPSISESAKDLVRKLLTKDPKQRISAAQALEHPWI 360 >At4g04740.1 68417.m00695 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Lycopersicon esculentum] gi|19171502|emb|CAC87494 Length = 520 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/61 (39%), Positives = 32/61 (52%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLX 206 K DF E + ISD AKD + K+L +D R+ A+ L HPW I+ E + T L Sbjct: 285 KIDFVREPWPSISDSAKDLVEKMLTEDPKRRITAAQVLEHPW-IKGGEAPEKPIDSTVLS 343 Query: 207 R 209 R Sbjct: 344 R 344 >At1g49580.1 68414.m05559 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820; contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 606 Score = 45.2 bits (102), Expect = 1e-04 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +3 Query: 36 FDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 FD+ + +S DAKDF+ +LL KD R+ AS L HPW+ Sbjct: 373 FDEPPWPFLSSDAKDFVKRLLFKDPRRRMSASQALMHPWI 412 >At4g23650.1 68417.m03405 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 529 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 2/91 (2%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXRY 212 DF + + +SD AKD + K+L D DRL A+ L HPW+ + ++ + L R Sbjct: 296 DFSADPWPALSDGAKDLVRKMLKYDPKDRLTAAEVLNHPWIREDGEASDKPLDNAVLSR- 354 Query: 213 VIKKRWAKAVSAVIALKRMGAKF--EDVHEE 299 K A+ LK+M K E++ EE Sbjct: 355 ------MKQFRAMNKLKKMALKVIAENLSEE 379 >At4g35310.1 68417.m05019 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 556 Score = 44.0 bits (99), Expect = 2e-04 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 2/91 (2%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXRY 212 DF+ + + ISD AKD I ++L +RL A L HPW+ ++ + + + L R Sbjct: 315 DFESDPWPVISDSAKDLIRRMLSSKPAERLTAHEVLRHPWICENGVAPDRALDPAVLSR- 373 Query: 213 VIKKRWAKAVSAVIALKRMGAKF--EDVHEE 299 K SA+ LK+M K E + EE Sbjct: 374 ------LKQFSAMNKLKKMALKVIAESLSEE 398 >At3g57530.1 68416.m06406 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 538 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKT---KL 203 DF + + ++S++AKD I K+L D+ RL A L HPWL + + + +T +L Sbjct: 281 DFRRDPWPKVSENAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARL 340 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + + K VIA Sbjct: 341 KQFTVMNKLKKRALRVIA 358 >At3g56760.1 68416.m06313 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820 Length = 577 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = +3 Query: 24 AKYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQS 164 A+ +F++ + +S DA DF+ +LL KD RL A+ L HPWL+ S Sbjct: 343 AEPNFEEAPWPSLSPDAVDFVKRLLNKDYRKRLTAAQALCHPWLVGS 389 >At3g50530.1 68416.m05526 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820 Length = 601 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +3 Query: 36 FDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQS 164 FDD + +S +A+DF+ +LL KD RL A+ L+HPW+ S Sbjct: 371 FDDPPWPLLSSEARDFVKRLLNKDPRKRLTAAQALSHPWIKDS 413 >At3g49370.1 68416.m05397 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK1 [Nicotiana tabacum] gi|16904222|gb|AAL30818 Length = 594 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = +3 Query: 24 AKYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 A +FDD + IS AKDF+ +LL KD R+ A+ L HPWL Sbjct: 361 ANPNFDDLPWPSISPIAKDFVKRLLNKDHRKRMTAAQALAHPWL 404 >At5g24430.1 68418.m02879 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK1 [Nicotiana tabacum] gi|16904222|gb|AAL30818 Length = 594 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/44 (45%), Positives = 27/44 (61%) Frame = +3 Query: 24 AKYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 A +F+D + IS AKDF+ +LL KD R+ A+ L HPWL Sbjct: 362 ANPNFEDMPWPSISPTAKDFVKRLLNKDHRKRMTAAQALAHPWL 405 >At5g04870.1 68418.m00510 calcium-dependent protein kinase isoform AK1 (AK1) identical to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 610 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 DF + + IS+ AKD + K+LV+D RL A L HPW+ Sbjct: 368 DFSSDPWPSISESAKDLVRKMLVRDPKKRLTAHQVLCHPWV 408 >At4g36070.1 68417.m05135 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 536 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/54 (38%), Positives = 33/54 (61%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHV 188 K DF + + IS+ AKDF+ KLLVK+ RL A+ L+H W+ + +E+ + Sbjct: 286 KPDFREVPWPTISNGAKDFVKKLLVKEPRARLTAAQALSHSWVKEGGEASEVPI 339 >At3g19100.1 68416.m02427 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820; contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 599 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +3 Query: 36 FDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 FD+ + +S +AKDF+ +LL KD R+ AS L HPW+ Sbjct: 367 FDEPPWPSLSFEAKDFVKRLLYKDPRKRMTASQALMHPWI 406 >At2g46700.1 68415.m05827 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase homolog MCK1 [Zea mays] gi|1839597|gb|AAB47181 Length = 595 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/59 (35%), Positives = 31/59 (52%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXR 209 ++DD + S + KDF+ +LL KD R+ A LTHPWL + L + KL + Sbjct: 365 NYDDVPWPSCSSEGKDFVKRLLNKDYRKRMSAVQALTHPWLRDDSRVIPLDILIYKLVK 423 >At1g50700.1 68414.m05701 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 521 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXR 209 DF+ + + IS+ AKD + ++L +D R+ A+ L HPWL + ++ + L R Sbjct: 291 DFESQPWPSISNSAKDLVRRMLTQDPKRRISAAEVLKHPWLREGGEASDKPIDSAVLSR 349 >At4g04720.1 68417.m00693 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase(CDPK) [Carrot] SWISS-PROT:P28582 Length = 531 Score = 43.2 bits (97), Expect = 4e-04 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 DF E + IS+ AKD + K+L KD R+ A+ L HPW+ Sbjct: 298 DFVSEPWPSISESAKDLVRKMLTKDPKRRITAAQVLEHPWI 338 >At3g10660.1 68416.m01282 calcium-dependent protein kinase isoform 2 (CPK2) identical to calcium-dependent protein kinase isoform 2 [Arabidopsis thaliana] gi|9837343|gb|AAG00535; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 646 Score = 43.2 bits (97), Expect = 4e-04 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 DF + + IS+ AKD + K+LV+D RL A L HPW+ Sbjct: 404 DFSSDPWPSISESAKDLVRKMLVRDPKRRLTAHQVLCHPWV 444 >At2g41860.2 68415.m05174 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 530 Score = 42.7 bits (96), Expect = 6e-04 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKT---KL 203 DF + + ++SD+AKD I K+L D RL A L HPW+ + + + +T +L Sbjct: 272 DFKRDPWPKVSDNAKDLIKKMLHPDPRRRLTAQQVLDHPWIQNGKNASNVSLGETVRARL 331 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + + K VIA Sbjct: 332 KQFSVMNKLKKRALRVIA 349 >At2g41860.1 68415.m05173 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 425 Score = 42.7 bits (96), Expect = 6e-04 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKT---KL 203 DF + + ++SD+AKD I K+L D RL A L HPW+ + + + +T +L Sbjct: 167 DFKRDPWPKVSDNAKDLIKKMLHPDPRRRLTAQQVLDHPWIQNGKNASNVSLGETVRARL 226 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + + K VIA Sbjct: 227 KQFSVMNKLKKRALRVIA 244 >At1g76040.2 68414.m08829 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 534 Score = 42.7 bits (96), Expect = 6e-04 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSAL 170 K D + + IS+ AKD I K+L++D R+ A+ L HPW+ + + Sbjct: 301 KLDLETSPWPTISESAKDLIRKMLIRDPKKRITAAEALEHPWMTDTKI 348 >At1g76040.1 68414.m08830 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 323 Score = 42.7 bits (96), Expect = 6e-04 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSAL 170 K D + + IS+ AKD I K+L++D R+ A+ L HPW+ + + Sbjct: 90 KLDLETSPWPTISESAKDLIRKMLIRDPKKRITAAEALEHPWMTDTKI 137 >At5g12480.1 68418.m01466 calmodulin-domain protein kinase isoform 7 (CPK7) identical to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 535 Score = 42.3 bits (95), Expect = 8e-04 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTEL---HVTKTKL 203 DF + + +SD AKD + K+L D RL A+ L H W++ + + K +L Sbjct: 277 DFKRDPWPRVSDSAKDLVRKMLEPDPKKRLTAAQVLEHTWILNAKKAPNVSLGETVKARL 336 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + + K VIA Sbjct: 337 KQFSVMNKLKKRALRVIA 354 >At2g41140.1 68415.m05081 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820 Length = 576 Score = 42.3 bits (95), Expect = 8e-04 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = +3 Query: 24 AKYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQS 164 A+ +F++ + +S +A DF+ +LL KD RL A+ L HPWL+ S Sbjct: 342 AEPNFEEAPWPSLSPEAVDFVKRLLNKDYRKRLTAAQALCHPWLVGS 388 >At5g12180.1 68418.m01429 calcium-dependent protein kinase, putative / CDPK, putative Length = 528 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTEL---HVTKTKL 203 DF + + IS AKD + K+L D RL A+ L HPW+ + ++ + ++L Sbjct: 291 DFSSDPWPSISPQAKDLVKKMLNSDPKQRLTAAQVLNHPWIKEDGEAPDVPLDNAVMSRL 350 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + K VIA Sbjct: 351 KQFKAMNNFKKVALRVIA 368 >At3g20410.1 68416.m02585 calmodulin-domain protein kinase isoform 9 (CPK9) identical to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 541 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXR 209 DF+ + + IS AKD + ++L D R+ A+ L HPWL + ++ + L R Sbjct: 309 DFESQPWPSISSSAKDLVRRMLTADPKRRISAADVLQHPWLREGGEASDKPIDSAVLSR 367 >At2g45490.1 68415.m05658 protein kinase, putative contains protein kinase domain, Pfam:PF00069; similar to protein kinase p46XlEg22 [Xenopus laevis] gi|609280|emb|CAA78914 Length = 288 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = +3 Query: 21 VAKYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSA 167 + K D +S++AK+ I +LLVKD RL + HPW++++A Sbjct: 229 ILKIDLSFPLTPNVSEEAKNLISQLLVKDPSKRLSIEKIMQHPWIVKNA 277 >At1g61950.1 68414.m06988 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GI:3283996 from [Nicotiana tabacum]; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 551 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/83 (28%), Positives = 39/83 (46%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXRY 212 DF+ E + IS+ AKD + +L D R A+ L HPW+ + ++ + L R Sbjct: 317 DFESEPWPSISESAKDLVRNMLKYDPKKRFTAAQVLEHPWIREGGEASDKPIDSAVLSR- 375 Query: 213 VIKKRWAKAVSAVIALKRMGAKF 281 K + A+ LK++ KF Sbjct: 376 ------MKQLRAMNKLKKLAFKF 392 >At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDPK1) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 545 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTEL---HVTKTKL 203 DF + + +IS+ AK + ++L D RL A L HPW+ + + + +++L Sbjct: 281 DFKRDPWPQISESAKSLVKQMLDPDPTKRLTAQQVLAHPWIQNAKKAPNVPLGDIVRSRL 340 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + R+ K V VIA Sbjct: 341 KQFSMMNRFKKKVLRVIA 358 >At2g35890.1 68415.m04406 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK). [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 520 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 2/90 (2%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXRY 212 D + + ++S+ AKD I K+L ++ RL A L HPW+ + + T L R Sbjct: 350 DLTSDPWPQVSESAKDLIRKMLERNPIQRLTAQQVLCHPWIRDEGNAPDTPLDTTVLSR- 408 Query: 213 VIKKRWAKAVSAVIALKRMGAKF--EDVHE 296 +KK A +AL+ + + E++HE Sbjct: 409 -LKKFSATDKLKKMALRVIAERLSEEEIHE 437 >At5g19360.1 68418.m02307 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748 Length = 523 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTEL---HVTKTKL 203 DF + + IS AKD + K+L D RL A+ L HPW+ + ++ + ++L Sbjct: 286 DFSSDPWPVISPQAKDLVRKMLNSDPKQRLTAAQVLNHPWIKEDGEAPDVPLDNAVMSRL 345 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + K VIA Sbjct: 346 KQFKAMNNFKKVALRVIA 363 >At4g04710.1 68417.m00692 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 575 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTEL-HVTKTKL 203 + DF+ + + IS AK IGK+L K +R+ A+ L HPW+ A + +V +++ Sbjct: 249 RLDFESQPWPLISFKAKHLIGKMLTKKPKERISAADVLEHPWMKSEAPDKPIDNVVLSRM 308 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + K VIA Sbjct: 309 KQFRAMNKLKKLALKVIA 326 >At4g38230.1 68417.m05399 calcium-dependent protein kinase, putative / CDPK, putative calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 340 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 2/91 (2%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXRY 212 DFD + + ISD AK+ I +L +RL A L HPW+ ++ + + + L R Sbjct: 98 DFDSDPWPLISDSAKNLIRGMLCSRPSERLTAHQVLRHPWICENGVAPDRALDPAVLSR- 156 Query: 213 VIKKRWAKAVSAVIALKRMGAKF--EDVHEE 299 K SA+ LK+M + E + EE Sbjct: 157 ------LKQFSAMNKLKQMALRVIAESLSEE 181 >At4g32830.1 68417.m04669 protein kinase, putative similar to protein kinase p46XlEg22 [Xenopus laevis] gi|609280|emb|CAA78914; contains protein kinase domain, Pfam:PF00069 Length = 294 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSA 167 IS AKD I ++LVK+ RL L HPW++Q+A Sbjct: 251 ISASAKDLISQMLVKESSQRLPLHKLLEHPWIVQNA 286 >At2g31500.1 68415.m03848 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 582 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/78 (23%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHV---TKTKL 203 DF+ + + ++S +AK+ + +L + RL L HPW+ + +++ +TK+ Sbjct: 284 DFERDPWPKVSHEAKELVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKI 343 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++++ R+ K V ++A Sbjct: 344 QQFLLMNRFKKKVLRIVA 361 >At2g25880.1 68415.m03106 serine/threonine protein kinase, putative similar to serine/threonine kinase Ayk1 [Mus musculus] gi|1763647|gb|AAB62982 Length = 282 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSA 167 +S AKD I ++LVK+ RL L HPW++Q+A Sbjct: 239 VSSSAKDLISQMLVKESTQRLALHKLLEHPWIVQNA 274 >At1g08650.1 68414.m00960 phosphoenolpyruvate carboxylase kinase identical to phosphoenolpyruvate carboxylase kinase [Arabidopsis thaliana] gi|6318613|gb|AAF06968; contains protein kinase domain, Pfam:PF00069 Length = 284 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/48 (45%), Positives = 26/48 (54%) Frame = +3 Query: 36 FDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTE 179 F + F +S AKDF+ KL+ KD R A L HPW IQ A TE Sbjct: 234 FPTKIFRGVSSMAKDFLRKLICKDASRRFSAEQALRHPW-IQRAGETE 280 >At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDPK2) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 495 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLX 206 K DF + + IS+ AKD I K+L + R+ A L HPW++ + + L Sbjct: 242 KLDFKSDPWPTISEAAKDLIYKMLERSPKKRISAHEALCHPWIVDEQAAPDKPLDPAVLS 301 Query: 207 R 209 R Sbjct: 302 R 302 >At4g09570.1 68417.m01575 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 501 Score = 39.9 bits (89), Expect = 0.004 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLI 158 K DF + + IS+ AKD I K+L + R+ A L HPW++ Sbjct: 241 KIDFKSDPWPTISEGAKDLIYKMLDRSPKKRISAHEALCHPWIV 284 >At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDPK9) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836938|gb|AAA67653; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 490 Score = 39.5 bits (88), Expect = 0.005 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTE 179 K +F+ + IS+ AKD I K+L + RL A L HPW++ + + Sbjct: 238 KLEFEINPWPSISESAKDLIKKMLESNPKKRLTAHQVLCHPWIVDDKVAPD 288 >At1g12680.1 68414.m01472 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 470 Score = 39.1 bits (87), Expect = 0.007 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLI 158 K DF+ + +S A+D + ++L +++ R+ A L HPW++ Sbjct: 313 KLDFNTGVWESVSKPARDLLARMLTREESARITADEVLRHPWIL 356 >At5g19450.2 68418.m02318 calcium-dependent protein kinase 19 (CDPK19) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655 Length = 533 Score = 38.7 bits (86), Expect = 0.009 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTEL---HVTKTKL 203 DF + + +S+ AKD + K+L D RL A+ L H W+ + + K +L Sbjct: 275 DFKRDPWPRVSETAKDLVRKMLEPDPKKRLSAAQVLEHSWIQNAKKAPNVSLGETVKARL 334 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + + K VIA Sbjct: 335 KQFSVMNKLKKRALRVIA 352 >At5g19450.1 68418.m02317 calcium-dependent protein kinase 19 (CDPK19) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655 Length = 533 Score = 38.7 bits (86), Expect = 0.009 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTEL---HVTKTKL 203 DF + + +S+ AKD + K+L D RL A+ L H W+ + + K +L Sbjct: 275 DFKRDPWPRVSETAKDLVRKMLEPDPKKRLSAAQVLEHSWIQNAKKAPNVSLGETVKARL 334 Query: 204 XRYVIKKRWAKAVSAVIA 257 ++ + + K VIA Sbjct: 335 KQFSVMNKLKKRALRVIA 352 >At2g38910.1 68415.m04783 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 583 Score = 38.7 bits (86), Expect = 0.009 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 33 DFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPW 152 DF E + +S+ AKD + ++L++D R+ L HPW Sbjct: 352 DFISEPWPSVSESAKDLVRRMLIRDPKKRMTTHEVLCHPW 391 >At1g05100.1 68414.m00513 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 339 Score = 37.1 bits (82), Expect = 0.028 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWLI 158 +++ AKDF+GK L K+ +R AS L HP+L+ Sbjct: 232 LTEQAKDFLGKCLKKEATERWTASQLLNHPFLV 264 >At3g04530.1 68416.m00480 phosphoenolpyruvate carboxylase kinase 2 (PPCK2) phosphoenolpyruvate carboxylase kinase 2 [Arabidopsis thaliana] gi|13877128|gb|AAK43710; contains protein kinase domain, Pfam:PF00069 Length = 278 Score = 35.1 bits (77), Expect = 0.11 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 36 FDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLI 158 F + F +S +AKD + K++ +D R A L H W++ Sbjct: 230 FPPKKFGSVSSEAKDLLRKMICRDVSRRFSAEDALRHSWMM 270 >At2g23080.1 68415.m02752 casein kinase II alpha chain, putative identical to probable casein kinase II, alpha chain [Arabidopsis thaliana] SWISS-PROT:O64817; similar to casein kinase II, alpha chain 1 [Arabidopsis thaliana] SWISS-PROT:Q08467 Length = 333 Score = 33.9 bits (74), Expect = 0.26 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQ 161 +S +A DF+ KLL D DRL A + HP+ Q Sbjct: 288 VSPEAIDFLDKLLQYDHQDRLTAREAMDHPYFAQ 321 >At1g12580.1 68414.m01461 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains similarity to calcium-dependent protein kinase GI:5162877 from [Marchantia polymorpha] Length = 522 Score = 33.5 bits (73), Expect = 0.35 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 36 FDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQ 161 F E ++ I+ AKD I +L D RL A L H W+ Q Sbjct: 263 FSAEPWDNITSYAKDLIRGMLCVDPSQRLSADEVLAHSWMEQ 304 >At3g50000.1 68416.m05467 casein kinase II alpha chain 2 identical to casein kinase II, alpha chain 2 (CK II) [Arabidopsis thaliana] SWISS-PROT:Q08466 Length = 403 Score = 33.1 bits (72), Expect = 0.46 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQ 161 +S +A D++ KLL D DRL A + HP+ Q Sbjct: 358 VSPEAIDYLDKLLRYDHQDRLTAKEAMAHPYFAQ 391 >At5g67080.1 68418.m08458 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 344 Score = 32.3 bits (70), Expect = 0.80 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 57 EISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 E+S+ +DF+ K VKD R A L HP++ Sbjct: 237 ELSEQGRDFLSKCFVKDPKKRWTAEMLLNHPFV 269 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +3 Query: 54 NEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXRYV 215 + +S D DF+ + KD R A L+HPW+ S + + + +Y+ Sbjct: 241 DSLSPDITDFLRQCFKKDSRQRPDAKTLLSHPWIRNSRRALQSSLRHSGTIKYM 294 >At2g32510.1 68415.m03972 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 372 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/32 (37%), Positives = 23/32 (71%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 ++++AKDF+ K L ++ ++R A+ L HP+L Sbjct: 228 LAEEAKDFLEKCLKREANERWTATQLLNHPFL 259 >At3g46160.1 68416.m04995 protein kinase-related contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 393 Score = 31.5 bits (68), Expect = 1.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 54 NEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 N +SD AKDF+ K L +D R + L H +L Sbjct: 299 NYLSDKAKDFLAKCLERDPSKRWSVDSLLEHEFL 332 >At3g06030.1 68416.m00688 NPK1-related protein kinase, putative (ANP3) similar to protein kinase [Nicotiana tabacum] gi|456309|dbj|BAA05648; identical to cDNA NPK1-related protein kinase 3 GI:2342426 Length = 651 Score = 31.5 bits (68), Expect = 1.4 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 57 EISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 ++S +AKDF+ K L K+ RL A+ L HP++ Sbjct: 298 DLSPEAKDFLMKCLHKEPSLRLSATELLQHPFV 330 >At2g17210.1 68415.m01987 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 715 Score = 31.5 bits (68), Expect = 1.4 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +3 Query: 162 SALCTELHVTKTKLXRYVIKKRWAKAVSAVIALKRMGAKFED 287 S LC++L +K+ + + +W + VS ++R G +F D Sbjct: 3 SHLCSKLQALSSKIKQASVSGKWREVVSGYSEIQRAGVQFND 44 >At5g67380.1 68418.m08496 casein kinase II alpha chain 1 identical to casein kinase II, alpha chain 1 (CK II) [Arabidopsis thaliana] SWISS-PROT:Q08467; contains protein kinase domain, Pfam:PF00069 Length = 409 Score = 31.1 bits (67), Expect = 1.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQ 161 +S +A DF+ KLL D DRL A + H + Q Sbjct: 364 VSPEAIDFLDKLLRYDHQDRLTAKEAMAHAYFAQ 397 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +3 Query: 54 NEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSALCTELHVTKTKLXRYV 215 + +S D DF+ KD R A L+HPW+ S + + RY+ Sbjct: 241 DSLSPDITDFLRLCFKKDSRQRPDAKTLLSHPWIRNSRRALRSSLRHSGTIRYM 294 >At5g10930.1 68418.m01268 CBL-interacting protein kinase 5 (CIPK5) identical to CBL-interacting protein kinase 5 GP|9280632|gb|AAF86504 [Arabidopsis thaliana] Length = 445 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 63 SDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 S +A+ I KLLV D D R+ A + PWL Sbjct: 237 SPEARRLISKLLVVDPDRRISIPAIMRTPWL 267 >At4g26890.1 68417.m03869 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 444 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 ISD AKDF+ L +D+ R L HP+L Sbjct: 222 ISDKAKDFLKNCLKEDQKQRWTVEELLKHPFL 253 >At5g22840.1 68418.m02670 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 538 Score = 29.9 bits (64), Expect = 4.3 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +3 Query: 27 KYDFDDEAFNEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 KYDF +E + I+ +DFI +L + R A+ LTHPWL Sbjct: 432 KYDFSEE--DAIA--MQDFITPILQFVPEKRPTAAQCLTHPWL 470 >At4g40010.1 68417.m05665 serine/threonine protein kinase, putative similar to serine-threonine protein kinase [Triticum aestivum] gi|2055374|gb|AAB58348 Length = 350 Score = 29.9 bits (64), Expect = 4.3 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQSAL 170 IS + K + ++ V D D R+ HPW ++ L Sbjct: 229 ISSECKHLLSRIFVADPDKRITVPEIEKHPWFLKGPL 265 >At1g07150.1 68414.m00761 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 499 Score = 29.9 bits (64), Expect = 4.3 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +3 Query: 21 VAKYDFDDE--AF-NEISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQ 161 +++ F DE F +++S+ +DF+ K L +D + R L HP+L Q Sbjct: 232 LSRISFSDELPVFPSKLSEIGRDFLEKCLKRDPNQRWSCDQLLQHPFLSQ 281 >At2g30040.1 68415.m03653 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 463 Score = 29.1 bits (62), Expect = 7.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWLIQ 161 +S+ +DF+ K L +D+ R L HP+L Q Sbjct: 239 LSELGRDFLEKCLKRDRSQRWSCDQLLQHPFLCQ 272 >At3g50310.1 68416.m05502 protein kinase-related contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 342 Score = 28.7 bits (61), Expect = 9.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 60 ISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 +S++ KDF+ K VKD R A L H ++ Sbjct: 237 LSEEGKDFLSKCFVKDPAKRWTAEMLLNHSFV 268 >At3g45240.1 68416.m04882 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 396 Score = 28.7 bits (61), Expect = 9.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 75 KDFIGKLLVKDKDDRLQASATLTHPWL 155 +D I LL KD + R+ A HPW+ Sbjct: 343 RDLIEGLLCKDPNQRMTLKAVAEHPWI 369 >At1g54960.1 68414.m06277 NPK1-related protein kinase, putative (ANP2) similar to protein kinase [Nicotiana tabacum] gi|456309|dbj|BAA05648; identical to cDNA NPK1-related protein kinase 2, partial cds GI:2342424 Length = 596 Score = 28.7 bits (61), Expect = 9.9 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 54 NEISDDAKDFIGKLLVKDKDDRLQASATLTHPWL 155 + IS DA DF+ K L ++ + R AS L HP++ Sbjct: 297 DNISSDANDFLLKCLQQEPNLRPTASELLKHPFV 330 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,671,922 Number of Sequences: 28952 Number of extensions: 188049 Number of successful extensions: 488 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 3778328064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -