BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_B03_e114_03.seq (1559 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 26 2.6 AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 25 5.9 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 7.8 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 26.2 bits (55), Expect = 2.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 310 SVSRSPPTHSSRRDLANRTSSALRISSMRYLLSVRSSSTQVTSC 441 +V+R HS R +R + + S +RY V + +TQV C Sbjct: 820 AVTRLMQNHSGPRTAKSRLLAYVAESVLRYAAPVWAEATQVREC 863 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 25.0 bits (52), Expect = 5.9 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 425 RK*LPVAIQTEQPDWRLAQEDDS 493 RK +PV ++PDW++ Q+DD+ Sbjct: 84 RKQIPVK---KEPDWKMDQQDDN 103 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.6 bits (51), Expect = 7.8 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +1 Query: 142 CSCSGCVRSTTACSFVSTRPQ*TCFVSLSPILHGAT 249 C C G TRP +CFVS+ +L T Sbjct: 74 CYCEGHCPGNLQNGTCETRPGGSCFVSVEAVLDEET 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 938,557 Number of Sequences: 2352 Number of extensions: 14912 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 183690540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -