BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_B02_e106_04.seq (1385 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 3.1 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 7.1 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 9.4 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 9.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 3.1 Identities = 12/42 (28%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +1 Query: 1252 PPXAXXXTSXXSXXXPXXXTX-PXXXPTPXPPPXPXPXXRPP 1374 P + S + P T P PT PP P +PP Sbjct: 1345 PAQSTTSVSTTTSWNPGSTTNYPEWQPTEWHPPIPPTSEKPP 1386 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.6 bits (46), Expect = 7.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 Query: 1327 PTPXPPPXPXPXXRPPXL 1380 P P PP P P PP + Sbjct: 176 PLPQVPPLPLPPIFPPTM 193 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.2 bits (45), Expect = 9.4 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 1315 PXXXPTPXPPP 1347 P PTP PPP Sbjct: 95 PTTPPTPSPPP 105 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.2 bits (45), Expect = 9.4 Identities = 15/79 (18%), Positives = 20/79 (25%) Frame = +1 Query: 1135 PXKXXATQXPPXXXPPAXGXXXGPXPPXTPSAXXXXXPPPPXAXXXTSXXSXXXPXXXTX 1314 P K A++ P P + P P+ PP + P Sbjct: 201 PTKVKASKASPAAAPRSVAT-----PTGIPTPSTSASPPTVNIKKESPQMQSYRPTGNIT 255 Query: 1315 PXXXPTPXPPPXPXPXXRP 1371 P T P P P Sbjct: 256 PHGSNTSSLITTPSPSASP 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,560 Number of Sequences: 336 Number of extensions: 3799 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 59 effective length of database: 102,761 effective search space used: 41309922 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -