BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_B01_e098_03.seq (1423 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26540.1 68417.m03823 protein kinase family protein Three fal... 29 5.6 >At4g26540.1 68417.m03823 protein kinase family protein Three false introns were added with non-consensus splice sites to circumenvent frameshifts likely due to sequencing errors; this is extremely unusual and is under investigation. Length = 1089 Score = 29.5 bits (63), Expect = 5.6 Identities = 21/90 (23%), Positives = 35/90 (38%), Gaps = 4/90 (4%) Frame = +2 Query: 410 GDAPISVTRPNSTRRFSLQNNYSRR*LPLYLSKISVLRAKFLDEGTKRSRLGLDLVSKAN 589 GD P+ + R + SL N +P+ + +S L L + + + N Sbjct: 131 GDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKN 190 Query: 590 GQAVETV----IRGFSPWQPLRCETVRCLG 667 Q + +RG PW+ CE + LG Sbjct: 191 LQVLRAGGNKNLRGELPWEIGNCENLVMLG 220 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,211,225 Number of Sequences: 28952 Number of extensions: 392510 Number of successful extensions: 788 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 3749412288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -