BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_A10_e169_02.seq (1499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 175 1e-43 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 63 5e-10 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 61 2e-09 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 59 1e-08 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 1e-08 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 58 2e-08 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-07 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 50 4e-06 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 50 4e-06 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 50 4e-06 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 4e-05 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 46 6e-05 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 46 6e-05 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 46 6e-05 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 46 6e-05 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 46 6e-05 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 46 6e-05 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 46 6e-05 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 46 6e-05 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 46 6e-05 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 46 6e-05 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 46 6e-05 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 46 6e-05 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 46 6e-05 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 46 6e-05 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 46 6e-05 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 46 6e-05 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 46 6e-05 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 46 6e-05 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 46 6e-05 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 46 6e-05 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 46 6e-05 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 46 6e-05 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 46 6e-05 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 46 6e-05 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 46 6e-05 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 46 6e-05 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 46 6e-05 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 46 6e-05 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 46 6e-05 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 46 6e-05 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 46 6e-05 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 46 6e-05 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 46 6e-05 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 46 6e-05 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 46 6e-05 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 46 6e-05 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 46 6e-05 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 46 6e-05 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 46 6e-05 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 46 6e-05 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 46 6e-05 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 46 6e-05 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 46 6e-05 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 46 6e-05 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 46 6e-05 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 46 6e-05 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 46 6e-05 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 46 6e-05 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 46 6e-05 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 46 6e-05 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08) 46 6e-05 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 46 6e-05 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 46 6e-05 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 46 6e-05 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7679| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 46 6e-05 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7304| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 46 6e-05 SB_7027| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_6958| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_5084| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_4603| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 46 6e-05 SB_4554| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_4385| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_4363| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_4332| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 46 6e-05 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 46 6e-05 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_3391| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 46 6e-05 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_2377| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_2289| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_2177| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1887| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1459| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1407| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_1055| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_931| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) 46 6e-05 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_278| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59734| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59691| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59574| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59521| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59292| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59178| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58804| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58763| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58688| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58626| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58592| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58200| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57995| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57875| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57777| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57569| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57528| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57143| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57123| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57090| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56957| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56844| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56710| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 46 6e-05 SB_56502| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56306| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 175 bits (425), Expect = 1e-43 Identities = 80/97 (82%), Positives = 91/97 (93%) Frame = +1 Query: 250 KLQEPILLLGKEKFSGVDIRVTVKGGGHVAQVYAIRQAISKALIAFYQKYVDEASKKEIK 429 K++EPILLLGKE+F GVDIRV VKGGGH +++YAIRQAISK+L+A+YQKYVDE SKKEI+ Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIYAIRQAISKSLVAYYQKYVDEVSKKEIR 70 Query: 430 DILVQYDRSLLVADPRRCEPKKFGGPGARARYQKSYR 540 DILVQYDRSLLVADPRR E KKFGGPGAR+RYQKSYR Sbjct: 71 DILVQYDRSLLVADPRRTEAKKFGGPGARSRYQKSYR 107 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.3 bits (157), Expect = 3e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 703 SRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 SRITIHWPS YNVVTG+NPGVTQLNRLAA PF+ Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFA 35 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 64.1 bits (149), Expect = 3e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 703 SRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 SRITIHWPS YNVVTG+N GVTQLNRLAA PF+ Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA 35 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 64.1 bits (149), Expect = 3e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 703 SRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 SRITIHWPS YNVVTG+N GVTQLNRLAA PF+ Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA 35 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 63.3 bits (147), Expect = 5e-10 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 777 IKLGNARVFPSHDVVNRRPVNCNTTHYRA 691 IKLGNA VFPSHDVV RRPVNCNTTHYRA Sbjct: 23 IKLGNASVFPSHDVVKRRPVNCNTTHYRA 51 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 63.3 bits (147), Expect = 5e-10 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 777 IKLGNARVFPSHDVVNRRPVNCNTTHYRA 691 IKLGNA VFPSHDVV RRPVNCNTTHYRA Sbjct: 37 IKLGNASVFPSHDVVKRRPVNCNTTHYRA 65 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.9 bits (146), Expect = 6e-10 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 703 SRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 SRITIHWPS YNVV ENPGVTQLNRLAA PF+ Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFA 35 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 61.7 bits (143), Expect = 1e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 777 IKLGNARVFPSHDVVNRRPVNCNTTHYRA 691 IKLGNA+ FPSHDVV RRPVNCNTTHYRA Sbjct: 29 IKLGNAKGFPSHDVVKRRPVNCNTTHYRA 57 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 61.7 bits (143), Expect = 1e-09 Identities = 33/57 (57%), Positives = 35/57 (61%) Frame = +1 Query: 691 RPIVSRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFSXSXX**AXEAPHPIXPSQQ 861 RPIVSRITIHWPS Y ENPGV QLNRLAA PF+ + E PSQQ Sbjct: 19 RPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWR---SSEEARTDRPSQQ 72 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +1 Query: 679 GTQFRPIVSRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 G RPIVSRITIHWP+ YN TG+ TQLNRLAA PF+ Sbjct: 37 GAPIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFA 78 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 59.7 bits (138), Expect = 6e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 777 IKLGNARVFPSHDVVNRRPVNCNTTHYRA 691 IKLGNA VF SHDVV RRPVNCNTTHYRA Sbjct: 11 IKLGNASVFRSHDVVKRRPVNCNTTHYRA 39 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 58.8 bits (136), Expect = 1e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 777 IKLGNARVFPSHDVVNRRPVNCNTTHYRA 691 IKL +A VFPSHDVV RRPVNCNTTHYRA Sbjct: 31 IKLAHASVFPSHDVVKRRPVNCNTTHYRA 59 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.8 bits (136), Expect = 1e-08 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 703 SRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 SRITIHWPS YNV+ + PGVTQLNRLAA PF+ Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFA 35 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.4 bits (135), Expect = 1e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 703 SRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 SRITIHWPS YNVVTG+ VTQLNRLAA PF+ Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFA 35 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 57.6 bits (133), Expect = 2e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 777 IKLGNARVFPSHDVVNRRPVNCNTTHYRA 691 IKLGNAR FPSHD RRPVNCNTTHYRA Sbjct: 68 IKLGNARGFPSHDGEKRRPVNCNTTHYRA 96 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 56.0 bits (129), Expect = 7e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 777 IKLGNARVFPSHDVVNRRPVNCNTTHYRA 691 +KLG + FPSHDVV RRPVNCNTTHYRA Sbjct: 72 LKLGKRQGFPSHDVVKRRPVNCNTTHYRA 100 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 54.4 bits (125), Expect = 2e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +1 Query: 700 VSRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 +SRITIHWPSV ENPGVTQLNRLAA PF+ Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFA 311 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 52.8 bits (121), Expect = 7e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 765 NARVFPSHDVVNRRPVNCNTTHYRA 691 +A VFPSHDVV RRPVNCNTTHYRA Sbjct: 33 HAIVFPSHDVVKRRPVNCNTTHYRA 57 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 52.0 bits (119), Expect = 1e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +1 Query: 718 HWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 HWPS YNVVTG+ GVTQLNRLAA PF+ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFA 33 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 52.0 bits (119), Expect = 1e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 756 VFPSHDVVNRRPVNCNTTHYRA 691 VFPSHDVV RRPVNCNTTHYRA Sbjct: 1876 VFPSHDVVKRRPVNCNTTHYRA 1897 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 753 FPSHDVVNRRPVNCNTTHYRA 691 FPSHDVV RRPVNCNTTHYRA Sbjct: 2 FPSHDVVKRRPVNCNTTHYRA 22 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 753 FPSHDVVNRRPVNCNTTHYRA 691 FPSHDVV RRPVNCNTTHYRA Sbjct: 58 FPSHDVVKRRPVNCNTTHYRA 78 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 753 FPSHDVVNRRPVNCNTTHYRA 691 FPSHDVV RRPVNCNTTHYRA Sbjct: 626 FPSHDVVKRRPVNCNTTHYRA 646 Score = 32.7 bits (71), Expect = 0.78 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 863 NCWEGXIGCGASXAYYXXLXEKGDCAARRLSWVTPGFSPV 744 NCWEG +S KG CAARRLSW P V Sbjct: 596 NCWEGRSVRASSLLRQLA---KGGCAARRLSWGFPSHDVV 632 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 753 FPSHDVVNRRPVNCNTTHYRA 691 FPSHDVV RRPVNCNTTHYRA Sbjct: 58 FPSHDVVKRRPVNCNTTHYRA 78 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/42 (52%), Positives = 24/42 (57%) Frame = -1 Query: 878 IQAGANCWEGXIGCGASXAYYXXLXEKGDCAARRLSWVTPGF 753 +Q NCWEG +S KG CAARRLSWVTPGF Sbjct: 20 VQQLRNCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGF 58 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 753 FPSHDVVNRRPVNCNTTHYRA 691 FPSHDVV RRPVNCNTTHYRA Sbjct: 69 FPSHDVVKRRPVNCNTTHYRA 89 Score = 32.7 bits (71), Expect = 0.78 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 863 NCWEGXIGCGASXAYYXXLXEKGDCAARRLSWVTPGFSPV 744 NCWEG +S KG CAARRLSW P V Sbjct: 39 NCWEGRSVRASSLLRQLA---KGGCAARRLSWGFPSHDVV 75 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 753 FPSHDVVNRRPVNCNTTHYRA 691 FPSHDVV RRPVNCNTTHYRA Sbjct: 69 FPSHDVVKRRPVNCNTTHYRA 89 Score = 32.7 bits (71), Expect = 0.78 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 863 NCWEGXIGCGASXAYYXXLXEKGDCAARRLSWVTPGFSPV 744 NCWEG +S KG CAARRLSW P V Sbjct: 39 NCWEGRSVRASSLLRQLA---KGGCAARRLSWGFPSHDVV 75 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 48.8 bits (111), Expect = 1e-05 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 669 GGARYPISPYSESYYNSLAVGLQRRDWGKP 758 GGA PI PYSESYY+SLAVGLQR DW P Sbjct: 51 GGA--PIRPYSESYYSSLAVGLQRLDWKNP 78 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 +NPGVT LNRL A PF+ Sbjct: 76 KNPGVTPLNRLEAHPPFA 93 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 46.8 bits (106), Expect = 4e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +1 Query: 703 SRITIHWPSVYNVVTGENPGVTQLNRLAAQSPFS 804 SRITIHWPS YNVVTG+ + L LAA PF+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFA 35 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 34 SPYSESYYNSLAVVLQRRDWENP 56 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 54 ENPGVTQLNRLAAHPPFA 71 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 57 SPYSESYYNSLAVVLQRRDWENP 79 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 77 ENPGVTQLNRLAAHPPFA 94 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 48 SPYSESYYNSLAVVLQRRDWENP 70 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 68 ENPGVTQLNRLAAHPPFA 85 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 25 SPYSESYYNSLAVVLQRRDWENP 47 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 45 ENPGVTQLNRLAAHPPFA 62 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 40 SPYSESYYNSLAVVLQRRDWENP 62 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 60 ENPGVTQLNRLAAHPPFA 77 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 49 SPYSESYYNSLAVVLQRRDWENP 71 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 69 ENPGVTQLNRLAAHPPFA 86 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 30 SPYSESYYNSLAVVLQRRDWENP 52 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 50 ENPGVTQLNRLAAHPPFA 67 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 206 SPYSESYYNSLAVVLQRRDWENP 228 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 226 ENPGVTQLNRLAAHPPFA 243 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 101 SPYSESYYNSLAVVLQRRDWENP 123 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 121 ENPGVTQLNRLAAHPPFA 138 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 37 SPYSESYYNSLAVVLQRRDWENP 59 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 57 ENPGVTQLNRLAAHPPFA 74 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 371 SPYSESYYNSLAVVLQRRDWENP 393 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 391 ENPGVTQLNRLAAHPPFA 408 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 29 SPYSESYYNSLAVVLQRRDWENP 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 49 ENPGVTQLNRLAAHPPFA 66 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 28 SPYSESYYNSLAVVLQRRDWENP 50 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 48 ENPGVTQLNRLAAHPPFA 65 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 35 SPYSESYYNSLAVVLQRRDWENP 57 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 55 ENPGVTQLNRLAAHPPFA 72 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 330 SPYSESYYNSLAVVLQRRDWENP 352 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 350 ENPGVTQLNRLAAHPPFA 367 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 70 SPYSESYYNSLAVVLQRRDWENP 92 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 90 ENPGVTQLNRLAAHPPFA 107 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 40 SPYSESYYNSLAVVLQRRDWENP 62 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 60 ENPGVTQLNRLAAHPPFA 77 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 49 SPYSESYYNSLAVVLQRRDWENP 71 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 69 ENPGVTQLNRLAAHPPFA 86 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 33 SPYSESYYNSLAVVLQRRDWENP 55 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 53 ENPGVTQLNRLAAHPPFA 70 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 124 SPYSESYYNSLAVVLQRRDWENP 146 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 144 ENPGVTQLNRLAAHPPFA 161 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 53 SPYSESYYNSLAVVLQRRDWENP 75 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 73 ENPGVTQLNRLAAHPPFA 90 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 29 SPYSESYYNSLAVVLQRRDWENP 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 49 ENPGVTQLNRLAAHPPFA 66 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 57 SPYSESYYNSLAVVLQRRDWENP 79 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 77 ENPGVTQLNRLAAHPPFA 94 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 246 SPYSESYYNSLAVVLQRRDWENP 268 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 266 ENPGVTQLNRLAAHPPFA 283 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 26 SPYSESYYNSLAVVLQRRDWENP 48 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 46 ENPGVTQLNRLAAHPPFA 63 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 104 SPYSESYYNSLAVVLQRRDWENP 126 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 124 ENPGVTQLNRLAAHPPFA 141 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 24 SPYSESYYNSLAVVLQRRDWENP 46 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 44 ENPGVTQLNRLAAHPPFA 61 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 386 SPYSESYYNSLAVVLQRRDWENP 408 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 406 ENPGVTQLNRLAAHPPFA 423 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 109 SPYSESYYNSLAVVLQRRDWENP 131 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 129 ENPGVTQLNRLAAHPPFA 146 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 404 SPYSESYYNSLAVVLQRRDWENP 426 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 424 ENPGVTQLNRLAAHPPFA 441 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 46 SPYSESYYNSLAVVLQRRDWENP 68 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 66 ENPGVTQLNRLAAHPPFA 83 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 36 SPYSESYYNSLAVVLQRRDWENP 58 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 56 ENPGVTQLNRLAAHPPFA 73 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 53 SPYSESYYNSLAVVLQRRDWENP 75 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 73 ENPGVTQLNRLAAHPPFA 90 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 175 SPYSESYYNSLAVVLQRRDWENP 197 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 195 ENPGVTQLNRLAAHPPFA 212 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 24 SPYSESYYNSLAVVLQRRDWENP 46 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 44 ENPGVTQLNRLAAHPPFA 61 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 30 SPYSESYYNSLAVVLQRRDWENP 52 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 50 ENPGVTQLNRLAAHPPFA 67 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 44 SPYSESYYNSLAVVLQRRDWENP 66 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 64 ENPGVTQLNRLAAHPPFA 81 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 41 SPYSESYYNSLAVVLQRRDWENP 63 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 61 ENPGVTQLNRLAAHPPFA 78 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 25 SPYSESYYNSLAVVLQRRDWENP 47 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 45 ENPGVTQLNRLAAHPPFA 62 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 39 SPYSESYYNSLAVVLQRRDWENP 61 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 59 ENPGVTQLNRLAAHPPFA 76 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 29 SPYSESYYNSLAVVLQRRDWENP 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 49 ENPGVTQLNRLAAHPPFA 66 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 74 SPYSESYYNSLAVVLQRRDWENP 96 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 94 ENPGVTQLNRLAAHPPFA 111 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 330 SPYSESYYNSLAVVLQRRDWENP 352 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 350 ENPGVTQLNRLAAHPPFA 367 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 76 SPYSESYYNSLAVVLQRRDWENP 98 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 96 ENPGVTQLNRLAAHPPFA 113 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 26 SPYSESYYNSLAVVLQRRDWENP 48 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 46 ENPGVTQLNRLAAHPPFA 63 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 284 SPYSESYYNSLAVVLQRRDWENP 306 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 304 ENPGVTQLNRLAAHPPFA 321 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 47 SPYSESYYNSLAVVLQRRDWENP 69 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 67 ENPGVTQLNRLAAHPPFA 84 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 401 SPYSESYYNSLAVVLQRRDWENP 423 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 421 ENPGVTQLNRLAAHPPFA 438 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 41 SPYSESYYNSLAVVLQRRDWENP 63 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 61 ENPGVTQLNRLAAHPPFA 78 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 33 SPYSESYYNSLAVVLQRRDWENP 55 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 53 ENPGVTQLNRLAAHPPFA 70 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 83 SPYSESYYNSLAVVLQRRDWENP 105 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 103 ENPGVTQLNRLAAHPPFA 120 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 201 SPYSESYYNSLAVVLQRRDWENP 223 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 221 ENPGVTQLNRLAAHPPFA 238 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 33 SPYSESYYNSLAVVLQRRDWENP 55 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 53 ENPGVTQLNRLAAHPPFA 70 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 33 SPYSESYYNSLAVVLQRRDWENP 55 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 53 ENPGVTQLNRLAAHPPFA 70 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 35 SPYSESYYNSLAVVLQRRDWENP 57 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 55 ENPGVTQLNRLAAHPPFA 72 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 25 SPYSESYYNSLAVVLQRRDWENP 47 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 45 ENPGVTQLNRLAAHPPFA 62 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 185 SPYSESYYNSLAVVLQRRDWENP 207 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 205 ENPGVTQLNRLAAHPPFA 222 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 43 SPYSESYYNSLAVVLQRRDWENP 65 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 63 ENPGVTQLNRLAAHPPFA 80 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 76 SPYSESYYNSLAVVLQRRDWENP 98 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 96 ENPGVTQLNRLAAHPPFA 113 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 39 SPYSESYYNSLAVVLQRRDWENP 61 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 59 ENPGVTQLNRLAAHPPFA 76 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 177 SPYSESYYNSLAVVLQRRDWENP 199 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 197 ENPGVTQLNRLAAHPPFA 214 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 57 SPYSESYYNSLAVVLQRRDWENP 79 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 77 ENPGVTQLNRLAAHPPFA 94 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 40 SPYSESYYNSLAVVLQRRDWENP 62 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 60 ENPGVTQLNRLAAHPPFA 77 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 66 SPYSESYYNSLAVVLQRRDWENP 88 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 86 ENPGVTQLNRLAAHPPFA 103 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 86 SPYSESYYNSLAVVLQRRDWENP 108 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 106 ENPGVTQLNRLAAHPPFA 123 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 30 SPYSESYYNSLAVVLQRRDWENP 52 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 50 ENPGVTQLNRLAAHPPFA 67 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 39 SPYSESYYNSLAVVLQRRDWENP 61 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 59 ENPGVTQLNRLAAHPPFA 76 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 653 SPYSESYYNSLAVVLQRRDWENP 675 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 673 ENPGVTQLNRLAAHPPFA 690 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 38 SPYSESYYNSLAVVLQRRDWENP 60 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 58 ENPGVTQLNRLAAHPPFA 75 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 27 SPYSESYYNSLAVVLQRRDWENP 49 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 47 ENPGVTQLNRLAAHPPFA 64 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 26 SPYSESYYNSLAVVLQRRDWENP 48 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 46 ENPGVTQLNRLAAHPPFA 63 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 33 SPYSESYYNSLAVVLQRRDWENP 55 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 53 ENPGVTQLNRLAAHPPFA 70 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 70 SPYSESYYNSLAVVLQRRDWENP 92 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 90 ENPGVTQLNRLAAHPPFA 107 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 20 SPYSESYYNSLAVVLQRRDWENP 42 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 40 ENPGVTQLNRLAAHPPFA 57 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 35 SPYSESYYNSLAVVLQRRDWENP 57 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 55 ENPGVTQLNRLAAHPPFA 72 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 65 SPYSESYYNSLAVVLQRRDWENP 87 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 85 ENPGVTQLNRLAAHPPFA 102 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 915 SPYSESYYNSLAVVLQRRDWENP 937 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 935 ENPGVTQLNRLAAHPPFA 952 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 36 SPYSESYYNSLAVVLQRRDWENP 58 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 56 ENPGVTQLNRLAAHPPFA 73 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 343 SPYSESYYNSLAVVLQRRDWENP 365 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 363 ENPGVTQLNRLAAHPPFA 380 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 65 SPYSESYYNSLAVVLQRRDWENP 87 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 85 ENPGVTQLNRLAAHPPFA 102 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 116 SPYSESYYNSLAVVLQRRDWENP 138 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 136 ENPGVTQLNRLAAHPPFA 153 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 87 SPYSESYYNSLAVVLQRRDWENP 109 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 107 ENPGVTQLNRLAAHPPFA 124 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 44 SPYSESYYNSLAVVLQRRDWENP 66 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 64 ENPGVTQLNRLAAHPPFA 81 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 94 SPYSESYYNSLAVVLQRRDWENP 116 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 114 ENPGVTQLNRLAAHPPFA 131 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 37 SPYSESYYNSLAVVLQRRDWENP 59 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 57 ENPGVTQLNRLAAHPPFA 74 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 898 SPYSESYYNSLAVVLQRRDWENP 920 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 918 ENPGVTQLNRLAAHPPFA 935 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 29 SPYSESYYNSLAVVLQRRDWENP 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 49 ENPGVTQLNRLAAHPPFA 66 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 33 SPYSESYYNSLAVVLQRRDWENP 55 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 53 ENPGVTQLNRLAAHPPFA 70 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 71 SPYSESYYNSLAVVLQRRDWENP 93 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 91 ENPGVTQLNRLAAHPPFA 108 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 46 SPYSESYYNSLAVVLQRRDWENP 68 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 66 ENPGVTQLNRLAAHPPFA 83 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 40 SPYSESYYNSLAVVLQRRDWENP 62 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 60 ENPGVTQLNRLAAHPPFA 77 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 42 SPYSESYYNSLAVVLQRRDWENP 64 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 62 ENPGVTQLNRLAAHPPFA 79 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 86 SPYSESYYNSLAVVLQRRDWENP 108 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 106 ENPGVTQLNRLAAHPPFA 123 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 65 SPYSESYYNSLAVVLQRRDWENP 87 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 85 ENPGVTQLNRLAAHPPFA 102 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 48 SPYSESYYNSLAVVLQRRDWENP 70 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 68 ENPGVTQLNRLAAHPPFA 85 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 61 SPYSESYYNSLAVVLQRRDWENP 83 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 81 ENPGVTQLNRLAAHPPFA 98 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 37 SPYSESYYNSLAVVLQRRDWENP 59 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 57 ENPGVTQLNRLAAHPPFA 74 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 43 SPYSESYYNSLAVVLQRRDWENP 65 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 63 ENPGVTQLNRLAAHPPFA 80 >SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 46 SPYSESYYNSLAVVLQRRDWENP 68 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 66 ENPGVTQLNRLAAHPPFA 83 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 102 SPYSESYYNSLAVVLQRRDWENP 124 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 122 ENPGVTQLNRLAAHPPFA 139 >SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 52 SPYSESYYNSLAVVLQRRDWENP 74 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 72 ENPGVTQLNRLAAHPPFA 89 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 63 SPYSESYYNSLAVVLQRRDWENP 85 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 83 ENPGVTQLNRLAAHPPFA 100 >SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 916 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 815 SPYSESYYNSLAVVLQRRDWENP 837 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 835 ENPGVTQLNRLAAHPPFA 852 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 62 SPYSESYYNSLAVVLQRRDWENP 84 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 82 ENPGVTQLNRLAAHPPFA 99 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 47 SPYSESYYNSLAVVLQRRDWENP 69 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 67 ENPGVTQLNRLAAHPPFA 84 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 771 SPYSESYYNSLAVVLQRRDWENP 793 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 791 ENPGVTQLNRLAAHPPFA 808 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 37 SPYSESYYNSLAVVLQRRDWENP 59 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 57 ENPGVTQLNRLAAHPPFA 74 >SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) Length = 372 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 61 SPYSESYYNSLAVVLQRRDWENP 83 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 81 ENPGVTQLNRLAAHPPFA 98 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 164 SPYSESYYNSLAVVLQRRDWENP 186 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 184 ENPGVTQLNRLAAHPPFA 201 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 24 SPYSESYYNSLAVVLQRRDWENP 46 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 44 ENPGVTQLNRLAAHPPFA 61 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 32 SPYSESYYNSLAVVLQRRDWENP 54 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 52 ENPGVTQLNRLAAHPPFA 69 >SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 103 SPYSESYYNSLAVVLQRRDWENP 125 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 123 ENPGVTQLNRLAAHPPFA 140 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 58 SPYSESYYNSLAVVLQRRDWENP 80 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 78 ENPGVTQLNRLAAHPPFA 95 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 83 SPYSESYYNSLAVVLQRRDWENP 105 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 103 ENPGVTQLNRLAAHPPFA 120 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 46 SPYSESYYNSLAVVLQRRDWENP 68 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 66 ENPGVTQLNRLAAHPPFA 83 >SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) Length = 352 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 175 SPYSESYYNSLAVVLQRRDWENP 197 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 195 ENPGVTQLNRLAAHPPFA 212 >SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 26 SPYSESYYNSLAVVLQRRDWENP 48 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 46 ENPGVTQLNRLAAHPPFA 63 >SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 76 SPYSESYYNSLAVVLQRRDWENP 98 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 96 ENPGVTQLNRLAAHPPFA 113 >SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 29 SPYSESYYNSLAVVLQRRDWENP 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 49 ENPGVTQLNRLAAHPPFA 66 >SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 24 SPYSESYYNSLAVVLQRRDWENP 46 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 44 ENPGVTQLNRLAAHPPFA 61 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 546 SPYSESYYNSLAVVLQRRDWENP 568 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 566 ENPGVTQLNRLAAHPPFA 583 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 45 SPYSESYYNSLAVVLQRRDWENP 67 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 65 ENPGVTQLNRLAAHPPFA 82 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 44 SPYSESYYNSLAVVLQRRDWENP 66 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 64 ENPGVTQLNRLAAHPPFA 81 >SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 46 SPYSESYYNSLAVVLQRRDWENP 68 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 66 ENPGVTQLNRLAAHPPFA 83 >SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 56 SPYSESYYNSLAVVLQRRDWENP 78 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 76 ENPGVTQLNRLAAHPPFA 93 >SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 451 SPYSESYYNSLAVVLQRRDWENP 473 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 471 ENPGVTQLNRLAAHPPFA 488 >SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 24 SPYSESYYNSLAVVLQRRDWENP 46 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 44 ENPGVTQLNRLAAHPPFA 61 >SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) Length = 974 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 873 SPYSESYYNSLAVVLQRRDWENP 895 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 893 ENPGVTQLNRLAAHPPFA 910 >SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 226 SPYSESYYNSLAVVLQRRDWENP 248 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 246 ENPGVTQLNRLAAHPPFA 263 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 69 SPYSESYYNSLAVVLQRRDWENP 91 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 89 ENPGVTQLNRLAAHPPFA 106 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 36 SPYSESYYNSLAVVLQRRDWENP 58 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 56 ENPGVTQLNRLAAHPPFA 73 >SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 24 SPYSESYYNSLAVVLQRRDWENP 46 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 44 ENPGVTQLNRLAAHPPFA 61 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 25 SPYSESYYNSLAVVLQRRDWENP 47 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 45 ENPGVTQLNRLAAHPPFA 62 >SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 82 SPYSESYYNSLAVVLQRRDWENP 104 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 102 ENPGVTQLNRLAAHPPFA 119 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 1044 SPYSESYYNSLAVVLQRRDWENP 1066 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 1064 ENPGVTQLNRLAAHPPFA 1081 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 39 SPYSESYYNSLAVVLQRRDWENP 61 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 59 ENPGVTQLNRLAAHPPFA 76 >SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 55 SPYSESYYNSLAVVLQRRDWENP 77 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 75 ENPGVTQLNRLAAHPPFA 92 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 40 SPYSESYYNSLAVVLQRRDWENP 62 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 60 ENPGVTQLNRLAAHPPFA 77 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 143 SPYSESYYNSLAVVLQRRDWENP 165 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 163 ENPGVTQLNRLAAHPPFA 180 >SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) Length = 1312 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 615 SPYSESYYNSLAVVLQRRDWENP 637 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 635 ENPGVTQLNRLAAHPPFA 652 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 39 SPYSESYYNSLAVVLQRRDWENP 61 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 59 ENPGVTQLNRLAAHPPFA 76 >SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 75 SPYSESYYNSLAVVLQRRDWENP 97 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = -1 Query: 863 NCWEGXIGCGASXAYYXXLXEKGDCAARRLSWVTPGFS 750 NCWEG +S KG CAARRLSWVTPGFS Sbjct: 11 NCWEGRSVRASSLLRQLA---KGGCAARRLSWVTPGFS 45 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 95 ENPGVTQLNRLAAHPPFA 112 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/31 (58%), Positives = 19/31 (61%) Frame = -2 Query: 757 GFPQSRRCKPTASEL*YDSL*GEIGYRAPPR 665 GF QSRRCK TASE D L + R PPR Sbjct: 43 GFSQSRRCKTTASEFPGDPL---VLERPPPR 70 >SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) Length = 340 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 239 SPYSESYYNSLAVVLQRRDWENP 261 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 259 ENPGVTQLNRLAAHPPFA 276 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 34 SPYSESYYNSLAVVLQRRDWENP 56 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 54 ENPGVTQLNRLAAHPPFA 71 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 30 SPYSESYYNSLAVVLQRRDWENP 52 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 50 ENPGVTQLNRLAAHPPFA 67 >SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 345 SPYSESYYNSLAVVLQRRDWENP 367 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 365 ENPGVTQLNRLAAHPPFA 382 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 87 SPYSESYYNSLAVVLQRRDWENP 109 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 107 ENPGVTQLNRLAAHPPFA 124 >SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 85 SPYSESYYNSLAVVLQRRDWENP 107 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 105 ENPGVTQLNRLAAHPPFA 122 >SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 690 SPYSESYYNSLAVGLQRRDWGKP 758 SPYSESYYNSLAV LQRRDW P Sbjct: 19 SPYSESYYNSLAVVLQRRDWENP 41 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 751 ENPGVTQLNRLAAQSPFS 804 ENPGVTQLNRLAA PF+ Sbjct: 39 ENPGVTQLNRLAAHPPFA 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,678,397 Number of Sequences: 59808 Number of extensions: 636768 Number of successful extensions: 7258 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7244 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4859439678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -