BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_A10_e169_02.seq (1499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 24 9.9 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 24 9.9 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 24.2 bits (50), Expect = 9.9 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 150 LTAENLYGLDWFTSCLLHGSH-FDPRAEXPAAXG 52 LTAEN++ L + +C+ G + P A A G Sbjct: 366 LTAENMHNLPYLRACIKEGLRMYQPVAGNMRAAG 399 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 24.2 bits (50), Expect = 9.9 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 307 RVTVKGGGHVAQVYAIRQAISKALIAFYQKYV-DEASKKEI 426 RV G VA V A+ + I+ A FY KYV D+ +K I Sbjct: 140 RVFGISSGCVAFVMALERYIALAKPFFYHKYVTDKLIRKSI 180 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,131,019 Number of Sequences: 2352 Number of extensions: 22082 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 175562640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -