BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_A08_e153_02.seq (1506 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0107 - 843820-846335,846400-846511 31 3.1 03_06_0375 - 33474860-33474866,33475033-33475100,33475469-334755... 29 7.2 >12_01_0107 - 843820-846335,846400-846511 Length = 875 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +2 Query: 650 YVHFNCAALKPRQNGSGAGTLMKKTVLRHDLTCRSYKMRKYSLREECLRKLXG 808 ++ +NC+A + N + TVL H+ SYK +K ++R+ LR L G Sbjct: 658 HIPYNCSAWE--FNSYYQSSYAGSTVLEHESLRSSYKEQKRAVRKSILRSLSG 708 >03_06_0375 - 33474860-33474866,33475033-33475100,33475469-33475508, 33476298-33476421,33476906-33476973,33477089-33477155, 33477461-33477530,33477753-33477803,33477923-33477981, 33478026-33478056,33478631-33478834 Length = 262 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 343 DVNN*NKITDLLRGEVELR*IFVDNKISAYLY 438 DV+ NKIT+ R + L +FV+ K YLY Sbjct: 120 DVDTGNKITERFRTDEALERVFVEEKSFTYLY 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,233,047 Number of Sequences: 37544 Number of extensions: 434140 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4826476928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -