BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_A03_e113_01.seq (1504 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 2.5 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 25 4.3 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 5.7 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 5.7 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 25 5.7 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 25 5.7 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 25 5.7 DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 25 7.5 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 9.9 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 24 9.9 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 2.5 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 397 DTAKVKKKMLYSSSFDALK 453 DTAKV +K+ YSS+F L+ Sbjct: 257 DTAKVFQKIFYSSAFSKLR 275 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 25.4 bits (53), Expect = 4.3 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 522 RGETPRH*PSVNPMHLALPSTPPSHTRYERRVRGP 626 R +P+ P+V + P PP H++ RR P Sbjct: 48 RNGSPKFAPAVQSKNRMPPVPPPKHSQRRRRSSSP 82 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 127 VSDACKTTYEEIKKDKKHRYVXFYIRD 207 + AC +E+I + KH + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHPHPIIYLRD 121 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 127 VSDACKTTYEEIKKDKKHRYVXFYIRD 207 + AC +E+I + KH + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHPHPIIYLRD 121 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 127 VSDACKTTYEEIKKDKKHRYVXFYIRD 207 + AC +E+I + KH + Y+RD Sbjct: 47 ILSACSPYFEQIFVENKHPHPIIYLRD 73 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 127 VSDACKTTYEEIKKDKKHRYVXFYIRD 207 + AC +E+I + KH + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHLHPIIYLRD 121 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.0 bits (52), Expect = 5.7 Identities = 23/108 (21%), Positives = 46/108 (42%), Gaps = 3/108 (2%) Frame = +1 Query: 298 CRYGLFDFEYTHQCQGTSEASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVG--- 468 CR G +C G E ++ M CP A++++K+L ++ DA+ + Sbjct: 955 CRMGFTPSPDCIRCTGVPETAEHA----MFECPRFAEIRQKLLGEANTDAITPETLQFHL 1010 Query: 469 VQKYIQATDLSEASQEAVEEKLRATDRQ*IRCI*LSPQLPPHTHATND 612 +Q + + ++EA+++ R + + R S P H +D Sbjct: 1011 LQSQEKWSRIAEAAKQITSALQRDWNEERARLAVSSTLSPSHPVGPSD 1058 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 24.6 bits (51), Expect = 7.5 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +3 Query: 747 FTLQRVVFPITQQTFSVYRGPLPIPTQYSKRPCAAGFYWXFF 872 FTLQ ++ I F Y+G L P PC+ W F Sbjct: 215 FTLQSLIDGIDLTRFYTYKGSLTTP------PCSEAVTWVVF 250 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 9.9 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +1 Query: 469 VQKYIQATDLSEASQEAVEEKLR 537 ++KY++ DLSE +E ++ +L+ Sbjct: 896 IEKYLKPLDLSEKQKEEMKSQLK 918 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 24.2 bits (50), Expect = 9.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 379 GTISVSCSPPMYPGTDAC 326 G +V C+PP PG AC Sbjct: 32 GRQNVGCNPPGIPGGPAC 49 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,129,215 Number of Sequences: 2352 Number of extensions: 22034 Number of successful extensions: 66 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 175969035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -