BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_A02_e105_02.seq (1389 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 4.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 5.4 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 5.4 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.4 bits (48), Expect = 4.1 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 579 FHFSVKVNSKQIFCTREELFCTILEEKFEGVIINIDLILKSFT 707 FHFS+ IF + +L+E+ IN++ + FT Sbjct: 141 FHFSILQQFVAIFNEETDKLVEVLKEECYKPFINVNAHVAQFT 183 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.0 bits (47), Expect = 5.4 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 157 YTNLFSKYKTYFXKRTKDAHKVTFE 83 Y + S YF +T D H ++FE Sbjct: 560 YIDESSNSSNYFANKTYDFHNMSFE 584 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.0 bits (47), Expect = 5.4 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +3 Query: 579 FHFSVKVNSKQIFCTREELFCTILEEKFEGVIINIDLILKSFT 707 FHFS+ IF + +L+E+ +N++ + FT Sbjct: 141 FHFSILQQFVAIFNEETDKLVEVLKEECYKPFVNVNAHVAQFT 183 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,194 Number of Sequences: 336 Number of extensions: 4306 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 59 effective length of database: 102,761 effective search space used: 41412683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -