BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030712_A01_e097_01.seq (1414 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11E3.15 |rpl22|SPAP8A3.01|60S ribosomal protein L22|Schizosa... 85 2e-17 SPBC8D2.06 |||isoleucine-tRNA ligase |Schizosaccharomyces pombe|... 29 2.1 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 8.3 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 8.3 >SPAC11E3.15 |rpl22|SPAP8A3.01|60S ribosomal protein L22|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 85.0 bits (201), Expect = 2e-17 Identities = 43/99 (43%), Positives = 58/99 (58%), Gaps = 1/99 (1%) Frame = +2 Query: 224 ISLKFTIDCTHPAEDSILDVGNFEKYLKERVKVEGKTNNLGNHVVIARD-KTKVAINADI 400 +S K+ ID T D I DV FEKYL +R+KV+GKT NLG+ VV++R+ +K+A+ A I Sbjct: 8 VSNKYIIDATAAVNDKIFDVAAFEKYLIDRIKVDGKTGNLGSSVVVSREGSSKIAVIAHI 67 Query: 401 PFSXXXXXXXXXXXXXXXXXXDWLRVVASAHDSYELRYF 517 FS DWLRVV++ YELRY+ Sbjct: 68 DFSGRYLKYLTKKFLKKHSLRDWLRVVSTKKGVYELRYY 106 >SPBC8D2.06 |||isoleucine-tRNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1064 Score = 28.7 bits (61), Expect = 2.1 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = -2 Query: 354 T*LPRLFVLPSTLTRSFKYFSKLPTSRMLSSAGCVQSMVNLRLIF-LLAPLPRILPPFTP 178 T +P+L L +T + F++ R+ G ++++ L ++F +L L RI+ PFTP Sbjct: 714 TVVPQLLGLIEEMTNWYIRFNR---RRLKGEDGEIETINALNVLFEVLFTLVRIMGPFTP 770 Query: 177 FL 172 F+ Sbjct: 771 FI 772 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 8.3 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +3 Query: 627 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 791 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 792 SCA 800 S A Sbjct: 232 SDA 234 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 734 PPFASWRNSEEARTDRPSQQLRSLN 808 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,344,185 Number of Sequences: 5004 Number of extensions: 78443 Number of successful extensions: 162 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 75 effective length of database: 1,987,178 effective search space used: 784935310 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -