BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_H11_e88_15.seq (1515 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = -2 Query: 161 TVSESLMITCSLKKIILFLPSKLYSNKSSCRIXCSPGXXH*SLERPPPR 15 T S L +T ++K++ PS+ + S CSPG LERPPPR Sbjct: 5 TPSSKLTLTKGIQKLVPGPPSRSTVSISLISNSCSPGDPL-VLERPPPR 52 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 7.4 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = -2 Query: 161 TVSESLMITCSLKKIILFLPSKLYSNKSSCRIXCSPGXXH*SLERPPPR 15 T S L +T +K++ PS+ + S CSPG LERPPPR Sbjct: 5 TPSSKLTLTKGNRKLVPGPPSRSTVSISLISNSCSPGDPL-VLERPPPR 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,095,119 Number of Sequences: 59808 Number of extensions: 702372 Number of successful extensions: 1155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1153 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4918128563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -