BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_H11_e88_15.seq (1515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 25 7.6 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 24.6 bits (51), Expect = 7.6 Identities = 32/101 (31%), Positives = 44/101 (43%), Gaps = 6/101 (5%) Frame = +3 Query: 171 VMEENSRKSVKVVVLADIGRSPRMQYHALSLANNGFKVNIITYVETTPLTEITENPNIQ- 347 V E+N R+ VK+ V R Q+ ALS GF I++++ P E I Sbjct: 688 VTEDNKREYVKLYVNYRFMRGIEQQFLALS---KGFGELILSHL-LRPFDERELELLISG 743 Query: 348 ISKLHPLDYNKGPQLLQYVAKT-----IWQSISLLLTLFIS 455 ISK+ D+ +L Q A T WQ S L L +S Sbjct: 744 ISKIDVNDWKANTRLKQCTADTPQIVWFWQVSSTDLQLSMS 784 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,243,190 Number of Sequences: 2352 Number of extensions: 24089 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 177594615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -