Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030623sawa_H10_e80_16.seq
         (1533 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A7T395 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.53 
UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos...    29   9.1  
UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En...    29   9.3  

>UniRef50_A7T395 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 536

 Score = 38.3 bits (85), Expect = 0.53
 Identities = 22/66 (33%), Positives = 33/66 (50%)
 Frame = +2

Query: 155 HHGPARRAQVRWLLRLGGVRETRGDSAPAGPRPVATAPGRDLRADQLYALLNNILHNISF 334
           HH P   A++  L R+       G    A  R  A  P RDL +DQL ++  N + NI+F
Sbjct: 446 HHNPLSGAEIDRLARM--TEHYSGSDLTALARDAALGPIRDLNSDQLKSMAANEVRNITF 503

Query: 335 RFFFHN 352
           + F ++
Sbjct: 504 QDFVNS 509


>UniRef50_Q03173 Cluster: Protein enabled homolog; n=18;
           Euteleostomi|Rep: Protein enabled homolog - Mus musculus
           (Mouse)
          Length = 802

 Score = 28.7 bits (61), Expect(2) = 9.1
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -1

Query: 102 PPPPPPAPXXPXS 64
           PPPPPPAP  P S
Sbjct: 595 PPPPPPAPPLPAS 607



 Score = 24.2 bits (50), Expect(2) = 9.1
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -1

Query: 111 SXXPPPPPPAP 79
           S  PPPPPP P
Sbjct: 575 STGPPPPPPPP 585


>UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep:
           Enabled homolog - Rattus norvegicus (Rat)
          Length = 526

 Score = 28.7 bits (61), Expect(2) = 9.3
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -1

Query: 102 PPPPPPAPXXPXS 64
           PPPPPPAP  P S
Sbjct: 319 PPPPPPAPPLPAS 331



 Score = 24.2 bits (50), Expect(2) = 9.3
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -1

Query: 111 SXXPPPPPPAP 79
           S  PPPPPP P
Sbjct: 299 SAGPPPPPPPP 309


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 762,263,478
Number of Sequences: 1657284
Number of extensions: 13966505
Number of successful extensions: 80767
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 48374
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 69426
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 163731466850
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)