BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_H10_e80_16.seq (1533 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 27 1.6 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 25 2.3 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 25 2.3 02_05_0096 + 25785995-25786311,25786716-25786776,25787825-257880... 31 2.4 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 25 2.9 12_02_1070 - 25814741-25815850 25 3.0 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 25 3.1 08_02_0937 + 22801526-22802461 25 3.1 08_01_0111 + 850047-850218,850366-850649,851017-851763 25 3.9 07_03_1771 - 29404972-29405175,29405282-29405677 25 4.2 07_01_0583 + 4338003-4338377,4338455-4338647,4338734-4339326 25 5.1 07_01_0321 - 2255342-2255604,2256506-2256779,2256886-2257068 30 5.6 01_05_0423 + 22032940-22033695 30 5.6 01_03_0076 - 12241408-12241545,12241719-12241790,12242173-122422... 25 7.9 06_03_1037 - 27058002-27058082,27058856-27059041,27060033-270601... 29 9.8 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 26.6 bits (56), Expect(2) = 7.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 132 LHMS*XXSXXPPPPPPAPXXP 70 L S S PPPPPP P P Sbjct: 575 LPQSNYASSQPPPPPPPPPLP 595 Score = 25.8 bits (54), Expect(2) = 1.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP P P Sbjct: 636 PPPPPPPPSLP 646 Score = 25.0 bits (52), Expect(2) = 3.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP P P Sbjct: 618 PPPPPPPPPLP 628 Score = 24.2 bits (50), Expect(2) = 1.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPP P Sbjct: 631 SVLPPPPPPPP 641 Score = 23.8 bits (49), Expect(2) = 3.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPP P Sbjct: 616 SVPPPPPPPPP 626 Score = 21.0 bits (42), Expect(2) = 7.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -1 Query: 96 PPPPAPXXPXSCXXRGXP 43 PPPP P P S R P Sbjct: 634 PPPPPPPPPPSLPNRLVP 651 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 25.0 bits (52), Expect(2) = 2.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP P P Sbjct: 251 PPPPPPPPGPP 261 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPP P Sbjct: 201 STLPPPPPPPP 211 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 25.4 bits (53), Expect(2) = 2.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP P P Sbjct: 158 PPPPPPPPPAP 168 Score = 24.2 bits (50), Expect(2) = 2.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPP P Sbjct: 156 STPPPPPPPPP 166 >02_05_0096 + 25785995-25786311,25786716-25786776,25787825-25788059, 25788292-25788530,25789700-25789951,25790043-25790223, 25790864-25790952,25791269-25791342,25791481-25791584, 25791919-25791957,25792324-25792436 Length = 567 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 149 HAHHGPARRAQVRWLLRLGGVRETRGDSAPAGPRPVATAPGRD 277 H HH ++ Q +WL R RE G + P+ VA +P D Sbjct: 59 HNHHQQHQQQQQQWLRRNQIAREAAGTDRNSEPKAVAQSPAVD 101 >10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 Length = 746 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP P P Sbjct: 7 PPPPPPPPPRP 17 Score = 24.2 bits (50), Expect(2) = 2.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPP P Sbjct: 3 SRQPPPPPPPP 13 >12_02_1070 - 25814741-25815850 Length = 369 Score = 24.6 bits (51), Expect(2) = 3.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 147 ELSTALHMS*XXSXXPPPPPPAP 79 +L + +S + PPPPPP P Sbjct: 224 QLPPKIRLSPTQAPPPPPPPPPP 246 Score = 24.6 bits (51), Expect(2) = 3.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP P P Sbjct: 238 PPPPPPPPPPP 248 >04_04_0760 - 27837170-27837328,27837441-27837504,27837812-27838160, 27838906-27838960,27839489-27839821 Length = 319 Score = 25.4 bits (53), Expect(2) = 3.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 102 PPPPPPAPXXPXS 64 PPPPPP+ P S Sbjct: 11 PPPPPPSESTPTS 23 Score = 23.8 bits (49), Expect(2) = 3.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 + PPPPPP P Sbjct: 6 TTTPPPPPPPP 16 >08_02_0937 + 22801526-22802461 Length = 311 Score = 25.4 bits (53), Expect(2) = 3.1 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 99 PPPPPAPXXPXSC 61 PPPPP P P C Sbjct: 33 PPPPPPPSRPLFC 45 Score = 23.8 bits (49), Expect(2) = 3.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPAP Sbjct: 2 SASSPPPPPAP 12 >08_01_0111 + 850047-850218,850366-850649,851017-851763 Length = 400 Score = 25.0 bits (52), Expect(2) = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPP P Sbjct: 377 SAAPPPPPPPP 387 Score = 23.8 bits (49), Expect(2) = 3.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP+ P Sbjct: 382 PPPPPPSSATP 392 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 25.0 bits (52), Expect(2) = 4.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP P P Sbjct: 18 PPPPPPPPLPP 28 Score = 23.8 bits (49), Expect(2) = 4.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPP P Sbjct: 13 SPLPPPPPPPP 23 >07_01_0583 + 4338003-4338377,4338455-4338647,4338734-4339326 Length = 386 Score = 25.0 bits (52), Expect(2) = 5.1 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 111 SXXPPPPPPAP 79 S PPPPPP+P Sbjct: 286 SDKPPPPPPSP 296 Score = 23.4 bits (48), Expect(2) = 5.1 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 102 PPPPPPAPXXPXS 64 PPPPP P P S Sbjct: 290 PPPPPSPPPTPVS 302 >07_01_0321 - 2255342-2255604,2256506-2256779,2256886-2257068 Length = 239 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 102 PPPPPPAPXXPXSCXXRGXPXN 37 PPPPPP P P + P N Sbjct: 38 PPPPPPPPTDPAASTTPNAPRN 59 >01_05_0423 + 22032940-22033695 Length = 251 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 168 AGP*CACELSTALHMS*XXSXXPPPPPPAPXXPXSC 61 AGP + S + S PPPPPP P P +C Sbjct: 6 AGPSSSGHSSPTSNTSTTPPPQPPPPPPPPPHPQAC 41 >01_03_0076 - 12241408-12241545,12241719-12241790,12242173-12242289, 12243307-12245127,12245361-12245810 Length = 865 Score = 25.0 bits (52), Expect(2) = 7.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 129 HMS*XXSXXPPPPPPAP 79 H+ + PPPPPP P Sbjct: 122 HLPSSAAAPPPPPPPPP 138 Score = 22.6 bits (46), Expect(2) = 7.9 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -1 Query: 102 PPPPPPAPXXP 70 PPPPPP P Sbjct: 132 PPPPPPPEESP 142 >06_03_1037 - 27058002-27058082,27058856-27059041,27060033-27060176, 27060284-27061183 Length = 436 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 111 SXXPPPPPPAPXXPXSCXXRGXP 43 S PPPPPP P + RG P Sbjct: 128 SSEPPPPPPPRTLPSAGAGRGVP 150 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,151,532 Number of Sequences: 37544 Number of extensions: 396668 Number of successful extensions: 5211 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4117 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4930895900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -