BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_H06_e48_16.seq (1471 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 28 3.7 SPAC1B1.02c |||NAD/NADH kinase |Schizosaccharomyces pombe|chr 1|... 27 6.5 >SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 27.9 bits (59), Expect = 3.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 477 FPFACNDIHFENYFYLFGNKLVNEINVQSVRNFASIVCL 361 FP +D +F +FG L+N+IN Q + N ++V L Sbjct: 497 FPIHGDDSYFPREIQMFG--LINDINYQILSNMNNLVLL 533 >SPAC1B1.02c |||NAD/NADH kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 27.1 bits (57), Expect = 6.5 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 536 NSENIETEVQMYKGLLDTFNF 474 N E+IE V++ + LLDTF+F Sbjct: 172 NKESIERSVELAQWLLDTFSF 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,177,651 Number of Sequences: 5004 Number of extensions: 69548 Number of successful extensions: 111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 818637862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -