Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030623sawa_H03_e24_15.seq
         (1453 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory recept...    28   0.20 

>AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory receptor
           candidate 31 protein.
          Length = 250

 Score = 27.9 bits (59), Expect = 0.20
 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 2/58 (3%)
 Frame = -2

Query: 510 MQKYYTMNVF--KNYENIMNEKYYKKYYVYFTITDCQITSYYVLYLILLFSYYVW*FI 343
           +Q Y  +++F   ++E  + + Y   Y   FT+ D  +    +++ I + S + W FI
Sbjct: 48  IQCYIAVSIFGSSSFEADLRQFYKTAYSAIFTVIDFSLCKAILVHAITIRSTFSWTFI 105


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 233,281
Number of Sequences: 336
Number of extensions: 4827
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 43325775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)