BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_G10_e79_14.seq (1502 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 31 0.086 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 3.2 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 3.2 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 3.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 26 3.2 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 26 3.2 AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. 26 3.2 AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. 26 3.2 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 25 5.7 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 25 5.7 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 25 5.7 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 25 5.7 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 25 5.7 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 25 5.7 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 25 5.7 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 25 5.7 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 25 5.7 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 25 5.7 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 25 5.7 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 5.7 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 25 7.5 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 31.1 bits (67), Expect = 0.086 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +2 Query: 209 RKKETERVRSQSVPGHSPEHNEHHLGYNNRVFSQ-PATLAIYDPPSEYTYEIF 364 ++++ Q PGHS H+ HH + + Q A+ Y P E+ Y +F Sbjct: 165 QQQQPSSYHQQQHPGHSQHHHHHHHHHPHHSQQQHSASPRCYPMPPEHMYNMF 217 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 3.2 Identities = 14/68 (20%), Positives = 31/68 (45%) Frame = +2 Query: 398 DNLEKIRNSATENTDDFESIATNTEQLPTGRNQVKSNSDTHDGDIVKKETPVSRELATQK 577 D + + N+++ N+++ + ++N N +NS H G + KE +L + Sbjct: 187 DERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNNS-LHHGPLRDKELTEHEQLERLQ 245 Query: 578 RHIEAQVH 601 + + Q H Sbjct: 246 QQQQQQTH 253 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 3.2 Identities = 14/68 (20%), Positives = 31/68 (45%) Frame = +2 Query: 398 DNLEKIRNSATENTDDFESIATNTEQLPTGRNQVKSNSDTHDGDIVKKETPVSRELATQK 577 D + + N+++ N+++ + ++N N +NS H G + KE +L + Sbjct: 187 DERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNNS-LHHGPLRDKELTEHEQLERLQ 245 Query: 578 RHIEAQVH 601 + + Q H Sbjct: 246 QQQQQQTH 253 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 3.2 Identities = 14/68 (20%), Positives = 31/68 (45%) Frame = +2 Query: 398 DNLEKIRNSATENTDDFESIATNTEQLPTGRNQVKSNSDTHDGDIVKKETPVSRELATQK 577 D + + N+++ N+++ + ++N N +NS H G + KE +L + Sbjct: 139 DERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNNS-LHHGPLRDKELTEHEQLERLQ 197 Query: 578 RHIEAQVH 601 + + Q H Sbjct: 198 QQQQQQTH 205 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.8 bits (54), Expect = 3.2 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +2 Query: 338 PSEYTYEIFFSFINKQHLNDDNLEKIRNSATENTDDFESIATNTEQLPTGRNQVKS 505 PS+++ + F+ ++ NDDN ++ + +E + I T T K+ Sbjct: 481 PSDFSCHSYELFVGQEKGNDDNNKEKMSIRSEGLESVSEITRTTAPTATAAGTAKA 536 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 25.8 bits (54), Expect = 3.2 Identities = 17/80 (21%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +2 Query: 344 EYTYEIFFSFINKQHLNDDNLEKIRNSATENTDD--FESIATNTEQLPTGRNQVKSNSDT 517 EY ++ F F + +DD +++ + ++TD+ E T+T+ D Sbjct: 319 EYEFDDDFPFDDDSDFDDDVGDRLESEEEDSTDETLIEEELTDTDSSMCDSTNEDDGDDG 378 Query: 518 HDGDIVKKETPVSRELATQK 577 H + +E V R + K Sbjct: 379 HTLERAAEELTVRRSSRSTK 398 >AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.8 bits (54), Expect = 3.2 Identities = 17/80 (21%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +2 Query: 344 EYTYEIFFSFINKQHLNDDNLEKIRNSATENTDD--FESIATNTEQLPTGRNQVKSNSDT 517 EY ++ F F + +DD +++ + ++TD+ E T+T+ D Sbjct: 89 EYEFDDDFPFDDDSDFDDDVGDRLESEEEDSTDETLIEEELTDTDSSMCDSTNEDDGDDG 148 Query: 518 HDGDIVKKETPVSRELATQK 577 H + +E V R + K Sbjct: 149 HTLERAAEELTVRRSSRSTK 168 >AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.8 bits (54), Expect = 3.2 Identities = 17/80 (21%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +2 Query: 344 EYTYEIFFSFINKQHLNDDNLEKIRNSATENTDD--FESIATNTEQLPTGRNQVKSNSDT 517 EY ++ F F + +DD +++ + ++TD+ E T+T+ D Sbjct: 89 EYEFDDDFPFDDDSDFDDDVGDRLESEEEDSTDETLIEEELTDTDSSMCDSTNEDDGDDG 148 Query: 518 HDGDIVKKETPVSRELATQK 577 H + +E V R + K Sbjct: 149 HTLERAAEELTVRRSSRSTK 168 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 137 HADHHTGFNAVVRREPSAVKIAQP 160 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 129 HADHHTGFNAVVRREPSAVKIAQP 152 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 129 HADHHTGFNAVVRREPSAVKIAQP 152 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 129 HADHHTGFNAVVRREPSAVKIAQP 152 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 137 HADHHTGFNAVVRREPSAVKIAQP 160 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 129 HADHHTGFNAVVRREPSAVKIAQP 152 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 137 HADHHTGFNAVVRREPSAVKIAQP 160 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 161 HADHHTGFNAVVRREPSAVKIAQP 184 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 129 HADHHTGFNAVVRREPSAVKIAQP 152 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 129 HADHHTGFNAVVRREPSAVKIAQP 152 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 137 HADHHTGFNAVVRREPSAVKIAQP 160 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 129 HADHHTGFNAVVRPEPSAVKIAQP 152 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.6 bits (51), Expect = 7.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 266 HNEHHLGYNNRVFSQPATLAIYDP 337 H +HH G+N V +P+ + I P Sbjct: 137 HADHHTGFNAVVRREPSAVKIAHP 160 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,188,798 Number of Sequences: 2352 Number of extensions: 22995 Number of successful extensions: 68 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 175969035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -