BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_G06_e47_14.seq (1568 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3921| Best HMM Match : No HMM Matches (HMM E-Value=.) 123 3e-28 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 121 2e-27 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 95 1e-19 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 83 4e-16 SB_11289| Best HMM Match : zf-TRAF (HMM E-Value=1.7e-08) 73 8e-13 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 63 7e-10 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 62 9e-10 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 62 1e-09 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) 55 2e-07 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 52 1e-06 SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-06 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 50 5e-06 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 49 9e-06 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 48 3e-05 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 47 5e-05 SB_25653| Best HMM Match : U-box (HMM E-Value=0.0064) 46 8e-05 SB_23234| Best HMM Match : U-box (HMM E-Value=0.0064) 46 8e-05 SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) 46 1e-04 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43488| Best HMM Match : BRF1 (HMM E-Value=0.41) 44 3e-04 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 44 3e-04 SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) 44 3e-04 SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) 44 3e-04 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 44 3e-04 SB_34575| Best HMM Match : zf-TRAF (HMM E-Value=2.5e-15) 43 6e-04 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 43 6e-04 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 42 0.001 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 42 0.001 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 42 0.001 SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 42 0.001 SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.002 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 42 0.002 SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) 42 0.002 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 42 0.002 SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33822| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0022) 41 0.003 SB_20533| Best HMM Match : U-box (HMM E-Value=9.6e-25) 40 0.004 SB_35671| Best HMM Match : zf-C3HC4 (HMM E-Value=0.01) 40 0.005 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) 40 0.005 SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) 40 0.007 SB_23054| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.007 SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) 40 0.007 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.007 SB_31765| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 39 0.009 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 39 0.009 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 39 0.009 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 39 0.013 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.013 SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) 38 0.017 SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) 38 0.017 SB_54922| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0028) 38 0.017 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) 38 0.029 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 38 0.029 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.029 SB_7109| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0029) 37 0.038 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.038 SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.038 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 37 0.038 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.051 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 37 0.051 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 36 0.067 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 36 0.089 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.089 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.12 SB_4569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.12 SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.12 SB_55521| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-24) 36 0.12 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 35 0.15 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 35 0.20 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.20 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 35 0.20 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 35 0.20 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.20 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 35 0.20 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 35 0.20 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.20 SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) 35 0.20 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 35 0.20 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.20 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 34 0.27 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.27 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.27 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 34 0.27 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.36 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 34 0.36 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 34 0.36 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.36 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 34 0.36 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 34 0.36 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.36 SB_13095| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.36 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.36 SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) 33 0.47 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 33 0.62 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 33 0.82 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 33 0.82 SB_4351| Best HMM Match : zf-B_box (HMM E-Value=1.3e-25) 33 0.82 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 32 1.1 SB_11979| Best HMM Match : zf-C3HC4 (HMM E-Value=0.061) 32 1.1 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 32 1.4 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 32 1.4 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 32 1.4 SB_4080| Best HMM Match : zf-C3HC4 (HMM E-Value=0.23) 31 1.9 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 31 2.5 SB_43575| Best HMM Match : Sina (HMM E-Value=0) 31 2.5 SB_11968| Best HMM Match : zf-TRAF (HMM E-Value=0.32) 31 2.5 SB_42017| Best HMM Match : DUF1421 (HMM E-Value=0.43) 31 3.3 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 30 5.8 SB_59217| Best HMM Match : TRAUB (HMM E-Value=0.25) 29 7.7 SB_47089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_44729| Best HMM Match : SET (HMM E-Value=0) 29 7.7 SB_21939| Best HMM Match : F-box (HMM E-Value=0.001) 29 7.7 SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) 29 7.7 SB_106| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 >SB_3921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 123 bits (297), Expect = 3e-28 Identities = 68/169 (40%), Positives = 96/169 (56%), Gaps = 11/169 (6%) Frame = +3 Query: 441 VLKLDSLANHLVECEFNPKRPMPCEAGCGLVIPKDELADHNCVRELRALIATQQGKLNDY 620 +++LD L +HL +C+ NPKRP+ C+ GCGLV+P DEL HNCVREL +I +Q K+ + Sbjct: 1 MVRLDGLQSHLAQCDHNPKRPVQCDKGCGLVVPFDELQQHNCVRELNTIIQSQNLKMAEL 60 Query: 621 QLELAEQRLVINEHKRELALLKGIYEGHACIEPYYASSC*PDGTRGSSP---------LG 773 Q ++ +QR +NE KRE+ ++K + I P S P L Sbjct: 61 QAQIDDQRQQLNEQKREMQMMKEMIRTMRMINVPQTLPALPGPHTHSPPSMIEHNTDELL 120 Query: 774 EFPYHEQESRA--WGGMISTPDDVLQMMIXRSXLRVGMPAFHIDHLMEN 914 E+ Q +R WGGMISTPD VLQ +I R+ G P+ ++ LMEN Sbjct: 121 EWVLSLQPARVTRWGGMISTPDAVLQAVIRRALADSGCPSNILNELMEN 169 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 121 bits (291), Expect = 2e-27 Identities = 68/180 (37%), Positives = 102/180 (56%), Gaps = 2/180 (1%) Frame = +3 Query: 165 MGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAV 344 MG++I+RF G V+E L+C IC VLE+PL AP CEH++C AC+ W++ TCP DRQ++ Sbjct: 1 MGYDIERFVGAVNEGLLCCICRDVLEEPLMAP-CEHSYCSACVLGWLTHYNTCPEDRQSL 59 Query: 345 TASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHL-VECEFNPKRPMPC-EA 518 S L+P+ R ++N L L CD+ GC +V++L SLA HL EC+F + C Sbjct: 60 WPSDLKPIFRYMKNDLDSLKIHCDHQSKGCKSVVRLGSLARHLKEECDF---VAVACPNT 116 Query: 519 GCGLVIPKDELADHNCVRELRALIATQQGKLNDYQLELAEQRLVINEHKRELALLKGIYE 698 GC + + +L H + + + T+ L ELA Q INE + + K ++ Sbjct: 117 GCNESLNRCDLDTHLIICDFQTAKCTRGCGLQVNMNELA-QHNCINELRGSMEKQKSDFQ 175 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 107 bits (258), Expect = 2e-23 Identities = 58/167 (34%), Positives = 89/167 (53%), Gaps = 18/167 (10%) Frame = +3 Query: 165 MGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAV 344 MGF+I+RF V+++ C IC GVLEDPL C H FC C+ WI+ TCP+ + + Sbjct: 40 MGFDIERFLDPVEDDFKCGICFGVLEDPL-VTTCGHVFCSQCLVHWIAENGTCPLTCEQL 98 Query: 345 TASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEF------------ 488 L+ +P + R L+S L C N GC A+L+++S+ H +C++ Sbjct: 99 AIDDLKKIPPLTR-LISLLNIRCCNFQRGCPAILRIESIQTHQRKCQYAEGLTSGGKIMD 157 Query: 489 NPKRP------MPCEAGCGLVIPKDELADHNCVRELRALIATQQGKL 611 N P + CE GCGL + + +H+C++ L+ IA+ Q KL Sbjct: 158 NSDSPELSVQVVVCEKGCGLPLLFHDCTEHDCLKALQTHIASLQVKL 204 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 95.5 bits (227), Expect = 1e-19 Identities = 51/147 (34%), Positives = 84/147 (57%), Gaps = 2/147 (1%) Frame = +3 Query: 165 MGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQP--TCPVDRQ 338 MG+ + +F G +D+ L+C IC GVLE+ + C H+FC +C+ W+SR +CP R Sbjct: 1 MGYGLNKFVGKIDQNLLCNICVGVLENAITT-ICGHSFCESCLETWLSRPEVQSCPSCRS 59 Query: 339 AVTASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKRPMPCEA 518 V + L PV I R L+ L C+NA +GC+ V ++D++ +HL C P + C+A Sbjct: 60 HVLSLDLIPVHAI-RGLVDGLLVHCENADNGCDIVTRMDNMKSHLESC---PYGLVQCKA 115 Query: 519 GCGLVIPKDELADHNCVRELRALIATQ 599 C + + + +L H+ E+ +AT+ Sbjct: 116 -CEVKVKRIDLQTHHENCEVLNALATK 141 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 83.4 bits (197), Expect = 4e-16 Identities = 47/141 (33%), Positives = 71/141 (50%), Gaps = 8/141 (5%) Frame = +3 Query: 165 MGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQ--------PT 320 MG+ +++F VD L+C IC+ VLE + P C H+FC C+ W++ + + Sbjct: 1 MGYSVQQFIEKVDPNLLCGICAEVLERAVLTP-CGHSFCGVCLETWMNAKLEENEKCPAS 59 Query: 321 CPVDRQAVTASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKR 500 CP R + PV LR ++ L C NA +GC VLKL+ + HL C Sbjct: 60 CPSCRADLYQGDTIPV-LALRGIVDGLIVHCPNADNGCKLVLKLEGVEGHLKSCS---HA 115 Query: 501 PMPCEAGCGLVIPKDELADHN 563 P+ C GC + + ELA+H+ Sbjct: 116 PVQC-CGCSAFLKRGELAEHH 135 >SB_11289| Best HMM Match : zf-TRAF (HMM E-Value=1.7e-08) Length = 230 Score = 72.5 bits (170), Expect = 8e-13 Identities = 41/134 (30%), Positives = 69/134 (51%), Gaps = 3/134 (2%) Frame = +3 Query: 168 GFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISR--QPTCPVDRQA 341 GF+ +G D +ICPIC ++ED + P H FCR+C+ + + CP+DR Sbjct: 3 GFDPDFVEGPADPNIICPICQFIIEDAVCCPQ-GHIFCRSCVVVHLQQFGNGNCPLDRSE 61 Query: 342 VTASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKRPMPC-EA 518 ++ +RPV ++ +L+ +L + C C +LD H C+ ++P+PC Sbjct: 62 LSLEDIRPV-LMVNSLVGQLPSLCCEE---CPWRGRLDLRQGHTETCQ---EKPVPCRNV 114 Query: 519 GCGLVIPKDELADH 560 GC ++ + LADH Sbjct: 115 GCQTLVQRKNLADH 128 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 62.9 bits (146), Expect = 7e-10 Identities = 32/90 (35%), Positives = 47/90 (52%), Gaps = 3/90 (3%) Frame = +3 Query: 210 LICPICSGVLEDPLQAPACEHAFCRACITEWISR---QPTCPVDRQAVTASQLRPVPRIL 380 + C IC VL P+ P C+H FC CI EW+ + + CPV + +++ L +PR+L Sbjct: 158 VFCAICKEVLTQPIATP-CDHYFCVLCICEWLDQTYNKSGCPVCKASISPGVLHKIPRVL 216 Query: 381 RNLLSRLCTSCDNAPHGCNAVLKLDSLANH 470 N L+ SC C +LD+LA H Sbjct: 217 GNTLA----SCQVLCRSCKEPRRLDNLAAH 242 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 62.5 bits (145), Expect = 9e-10 Identities = 32/90 (35%), Positives = 47/90 (52%), Gaps = 3/90 (3%) Frame = +3 Query: 210 LICPICSGVLEDPLQAPACEHAFCRACITEWISR---QPTCPVDRQAVTASQLRPVPRIL 380 + C IC VL P+ P C+H FC CI EW+ + + CPV + +++ L +PR+L Sbjct: 32 VFCAICKEVLTQPIATP-CDHYFCVLCICEWLDQTYNKSGCPVCKASISPGVLHKIPRVL 90 Query: 381 RNLLSRLCTSCDNAPHGCNAVLKLDSLANH 470 N L+ SC C +LD+LA H Sbjct: 91 GNTLA----SCQVLCRSCKEPHRLDTLAAH 116 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 62.1 bits (144), Expect = 1e-09 Identities = 41/150 (27%), Positives = 67/150 (44%), Gaps = 7/150 (4%) Frame = +3 Query: 174 EIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISR---QPTCPVDRQAV 344 E +RF D + C IC VL P+ P C+H FC CI EW+ + + CPV + ++ Sbjct: 147 ETERFVSPPDF-VFCAICKEVLTQPIATP-CDHYFCVLCICEWLDQTYNKSGCPVCKASI 204 Query: 345 TASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKRPMPCEA-- 518 +++ L + R+L N L+ SC C +LD+L H C +P Sbjct: 205 SSNVLHKIQRVLGNTLA----SCQVLCRSCKEPHRLDTLPAHEAICTTYIAQPATTTVRE 260 Query: 519 --GCGLVIPKDELADHNCVRELRALIATQQ 602 G P ++ D C + ++ ++ Q Sbjct: 261 ILNAGKDTPLSQVEDRICTQLMKRKLSISQ 290 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 59.7 bits (138), Expect = 6e-09 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 6/79 (7%) Frame = +3 Query: 210 LICPICSGVLEDPLQAPACEHAFCRACITEWISR---QPTCPVDRQAVTASQLRPVPRIL 380 + C IC VL P+ P C+H FC CI EW+ + + CPV + +++ L +PR+L Sbjct: 158 VFCAICKEVLTQPIATP-CDHYFCVLCICEWLDQTYNKSGCPVCKASISPGVLHKIPRVL 216 Query: 381 RNLLSR---LCTSCDNAPH 428 N L+ LC SC PH Sbjct: 217 GNTLASCQVLCRSC-KEPH 234 >SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 55.2 bits (127), Expect = 1e-07 Identities = 44/171 (25%), Positives = 75/171 (43%), Gaps = 3/171 (1%) Frame = +3 Query: 153 KKADMGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVD 332 KK GFE F + + CPIC DP+Q C H FC +C+ P+ Sbjct: 22 KKEAGGFEAD-FVCTIPPDYQCPICQLPFRDPVQTRDCGHRFCESCLE---------PIL 71 Query: 333 RQAVTASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKRPMPC 512 R+ ++ ++ P R +LS L C N C V +L +L H+ C+ + P+ C Sbjct: 72 RRCISRDKVYPDKACKRTVLS-LTVKCPNHVTDCEWVGELGNLPVHIEACK---RVPIKC 127 Query: 513 EAGCGLV-IPKDELADHNCVRELRALIAT--QQGKLNDYQLELAEQRLVIN 656 CG I ++E+ + L+ +A+ + +LE ++++ N Sbjct: 128 VNNCGRTDIAREEVKRIEMEKHLQDSMASHLDMAHIRIRELEQRQEKICTN 178 >SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) Length = 499 Score = 54.8 bits (126), Expect = 2e-07 Identities = 28/91 (30%), Positives = 42/91 (46%) Frame = +3 Query: 210 LICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPRILRNL 389 L+C IC GV P+ C+ FC CIT W+ C R + S + P+ L N+ Sbjct: 330 LVCSICMGVPSTPV-VTQCDQIFCSGCITAWLRNAGACSSCRSVLEVSDIDPLKGPLLNI 388 Query: 390 LSRLCTSCDNAPHGCNAVLKLDSLANHLVEC 482 S + C + GC VL + +L ++ C Sbjct: 389 YSLVKIKCAFSCIGCLEVLAIKNLKDYESLC 419 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 52.0 bits (119), Expect = 1e-06 Identities = 29/93 (31%), Positives = 51/93 (54%), Gaps = 4/93 (4%) Frame = +3 Query: 135 VIQSSTKKADMGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQ 314 +I+S T + +K+ Q +++EL C +C V DP AC H+FC+ C+ + +S++ Sbjct: 41 IIKSKTLRVSKQSSLKKLQRALNDELRCSVCYEVFSDPRTLTACLHSFCKECLHKMLSKR 100 Query: 315 PT---CPVDRQAVTASQLRPVPRI-LRNLLSRL 401 CP+ R+ TA R V + L +++ RL Sbjct: 101 SKYIHCPLCRKK-TAVPRRGVKGLPLNSVIRRL 132 >SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 50.0 bits (114), Expect = 5e-06 Identities = 27/121 (22%), Positives = 50/121 (41%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPRI 377 + ++ IC C G+L P+Q C H C C T+ +S CP + + + + Sbjct: 425 LQKKYICLDCEGLLWYPVQIKPCGHRVCTKCYTKLLSSSARCPGCMDELN-ENIPDIDKA 483 Query: 378 LRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKRPMPCEAGCGLVIPKDELAD 557 + L C N C ++ ++H+ +C+++ + CE CG + L Sbjct: 484 FHEEIQELDVKCRNVEWNCKWEGCVNEFSSHVEKCDYS---DILCENDCGAKFQRRFLTK 540 Query: 558 H 560 H Sbjct: 541 H 541 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 50.0 bits (114), Expect = 5e-06 Identities = 26/91 (28%), Positives = 47/91 (51%) Frame = +3 Query: 150 TKKADMGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPV 329 TKKA+ K ++++E C +C + C H+FC C+ W+ ++ TCP+ Sbjct: 350 TKKAEEEAR-KSVVEEMEDEFSCIVCQELFIRATTL-TCSHSFCEYCLQSWLRKRNTCPI 407 Query: 330 DRQAVTASQLRPVPRILRNLLSRLCTSCDNA 422 R AV + +R + +L N ++++ S D A Sbjct: 408 CRCAVQSQPVRSI--VLDNAIAKMVDSMDVA 436 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 49.6 bits (113), Expect = 7e-06 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +3 Query: 195 DVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPV 329 D++ +IC +C G L D C H+FCR+CI W+ CPV Sbjct: 1359 DLNPHIICVLCGGYLVDATTIVECLHSFCRSCIVSWLQASYHCPV 1403 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 49.2 bits (112), Expect = 9e-06 Identities = 19/65 (29%), Positives = 34/65 (52%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPRILR 383 EE C +C + +P+ P C H FCRAC+ + +P CP+ R ++T + + +L+ Sbjct: 375 EEFECTLCCRLFYNPVTTP-CGHVFCRACLNRSLDHRPGCPICRSSLTQNVTVAIEMLLK 433 Query: 384 NLLSR 398 + Sbjct: 434 TFFPK 438 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISRQP---TCPVDR 335 EE+ CP+C V E+PL P+C H+ C C+ R P CPV R Sbjct: 19 EEISCPVCLEVFEEPLVLPSCGHSVCLQCLQNMTKRNPPSLLCPVCR 65 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 46.8 bits (106), Expect = 5e-05 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQ---PTCPVDRQAVTASQLRPV 368 V EE CPIC L+DP C H FC C+T+ I + P CP+ R V ++L V Sbjct: 61 VSEE--CPICLDPLDDP-SITRCAHVFCTGCLTDVIENEGLAPRCPMCRAPVNQNELVKV 117 Query: 369 P 371 P Sbjct: 118 P 118 >SB_25653| Best HMM Match : U-box (HMM E-Value=0.0064) Length = 336 Score = 46.0 bits (104), Expect = 8e-05 Identities = 27/90 (30%), Positives = 42/90 (46%) Frame = +3 Query: 192 GDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVP 371 GD ++ IC +C V+ P+ P C H+ C +C E ++R+ CP R+ A+ Sbjct: 48 GDAPDDFICNVCGTVMLVPVVMPNCGHSCCSSC-AERVNRK--CPECREEFGATAELKEN 104 Query: 372 RILRNLLSRLCTSCDNAPHGCNAVLKLDSL 461 L+ ++ RL C P L LD L Sbjct: 105 ISLKRIIRRLQGKCKRCPFNGELGLVLDHL 134 >SB_23234| Best HMM Match : U-box (HMM E-Value=0.0064) Length = 349 Score = 46.0 bits (104), Expect = 8e-05 Identities = 27/90 (30%), Positives = 42/90 (46%) Frame = +3 Query: 192 GDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVP 371 GD ++ IC +C V+ P+ P C H+ C +C E ++R+ CP R+ A+ Sbjct: 48 GDAPDDFICNVCGTVMLVPVVMPNCGHSCCSSC-AERVNRK--CPECREEFGATAELKEN 104 Query: 372 RILRNLLSRLCTSCDNAPHGCNAVLKLDSL 461 L+ ++ RL C P L LD L Sbjct: 105 ISLKRIIRRLQGKCKRCPFNGELGLVLDHL 134 >SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) Length = 137 Score = 45.6 bits (103), Expect = 1e-04 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = +3 Query: 213 ICPICSGVLEDPLQAPACEHAFCRACI-TEWISRQPTCPVDRQAVTASQLRPVPRILRNL 389 +CP+C + P+Q C H C+ C T W S +P CP ++ V + N Sbjct: 54 LCPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCP-KCSGDLDDKIPDVDQAFEND 112 Query: 390 LSRLCTSCDNAPHGC 434 ++ L C N GC Sbjct: 113 MNELPCRCINHEWGC 127 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 44.4 bits (100), Expect = 3e-04 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = +3 Query: 156 KADMGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +A G+E + F + EE CPIC DP+Q C H FC++C+ E Sbjct: 7 RATGGYEAE-FVEPLPEEYECPICQLAFRDPIQIEECGHRFCQSCLQE 53 >SB_43488| Best HMM Match : BRF1 (HMM E-Value=0.41) Length = 301 Score = 44.0 bits (99), Expect = 3e-04 Identities = 21/81 (25%), Positives = 41/81 (50%) Frame = +3 Query: 456 SLANHLVECEFNPKRPMPCEAGCGLVIPKDELADHNCVRELRALIATQQGKLNDYQLELA 635 S N L + KR + C +GCG+ + +E+ H+C+R+L+ + + L + + +A Sbjct: 18 SSINSLKDVRRYEKRTLACPSGCGIHLHLNEIPSHDCIRDLKQKVQGMEENLAELESRVA 77 Query: 636 EQRLVINEHKRELALLKGIYE 698 E + +K +L +G E Sbjct: 78 EMLAIEAYYKDKLTTQEGKME 98 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 44.0 bits (99), Expect = 3e-04 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 195 DVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPV 329 +++ +IC +C G L D C H+FCR CI ++ CPV Sbjct: 41 ELNPHIICVLCGGYLVDATTIIECLHSFCRCCIVRYLETSYRCPV 85 >SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) Length = 413 Score = 44.0 bits (99), Expect = 3e-04 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = +3 Query: 180 KRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQP--TCPVDRQAVTAS 353 K F+ + EE+ CPIC+ + E P P C H C +C+ + Q CP+ R+ + Sbjct: 10 KHFELFLQEEICCPICTEIFETPKCLPVCAHNVCLSCLKKMKIEQGFIKCPICRKKTKIT 69 Query: 354 QLRPVPRILRNLLSRLCTSCDNAP 425 P + N S L +NAP Sbjct: 70 --NPAESLPTN--SLLVRLVENAP 89 >SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) Length = 474 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 180 KRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPV-DRQAVTASQ 356 +R Q V L CP CS V++DP P C H+ C+ C+ + ++ CPV AV Sbjct: 7 ERVQPPVGVSLYCPACSNVIKDPRILP-CLHSICKTCLEKQLNGCLKCPVCSEHAVNIKS 65 Query: 357 LRPV 368 R V Sbjct: 66 PRDV 69 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 44.0 bits (99), Expect = 3e-04 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 195 DVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPV 329 +++ +IC +C G L D C H+FCR CI ++ CPV Sbjct: 9 ELNPHIICVLCGGYLVDATTIIECLHSFCRCCIVRYLETSYRCPV 53 >SB_34575| Best HMM Match : zf-TRAF (HMM E-Value=2.5e-15) Length = 262 Score = 43.2 bits (97), Expect = 6e-04 Identities = 25/80 (31%), Positives = 35/80 (43%) Frame = +3 Query: 321 CPVDRQAVTASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKR 500 CPVD A+ SQ+ + ++ L CD GC +L L HL EC+F Sbjct: 7 CPVDNTAIDYSQVY-ADDVTNQMIMSLTVICDYYQAGCKWKGQLRKLQGHLAECKF---V 62 Query: 501 PMPCEAGCGLVIPKDELADH 560 C CG I K +++H Sbjct: 63 SADCSNSCGARIQKRRMSEH 82 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 43.2 bits (97), Expect = 6e-04 Identities = 24/103 (23%), Positives = 42/103 (40%) Frame = +3 Query: 165 MGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAV 344 MG +++ F V E +C C V PL C H C C + + CP+ +++ Sbjct: 1 MGVDLEYFDDPVPSEFLCSYCRKVYLHPL-VTGCGHVLCTKCYNKRSKKHLGCPLCGKSM 59 Query: 345 TASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHL 473 + + + R R+ +C GC ++ + L HL Sbjct: 60 GEGKASDLDPMWRRRYERIHVNCTK---GCEQLITIRDLEAHL 99 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 43.2 bits (97), Expect = 6e-04 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 213 ICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQL 359 + P C L + C+H FC CI+ W R+ TCP+ R V + Sbjct: 482 VMPTCQVKLAKQIMLRTCKHIFCEDCISLWFDREQTCPMCRARVAGDPM 530 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 4/74 (5%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRAC---ITEWISRQPTCPVDRQAVT-ASQLRPVP 371 EE C IC VLE PL + C+H+ C C E + P CP+ ++ + + L+ P Sbjct: 164 EEFHCAICLDVLEKPLSS-KCQHSCCSDCWKSAFELGEKHPACPICQETLADPNDLQRAP 222 Query: 372 RILRNLLSRLCTSC 413 +L LL C Sbjct: 223 LVLIQLLEGYLVKC 236 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 4/74 (5%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRAC---ITEWISRQPTCPVDRQAVT-ASQLRPVP 371 EE C IC VLE PL + C+H+ C C E + P CP+ ++ + + L+ P Sbjct: 72 EEFHCAICLDVLEKPLSS-KCQHSCCSDCWKSAFELGEKHPACPICQETLADPNDLQRAP 130 Query: 372 RILRNLLSRLCTSC 413 +L LL C Sbjct: 131 LVLIQLLEGYLVKC 144 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISR-QPTCPVDRQAVTA 350 E+ CPIC +L +P+ P CEH FC+ C T+ + CP+ R +++ Sbjct: 33 EDFTCPICLQLLVEPVVLP-CEHEFCKMCFTQNVQEANLQCPMCRIRISS 81 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 41.9 bits (94), Expect = 0.001 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 204 EELICPICSGVL--EDPLQAPACEHAFCRACITEWISRQPTCPVDRQ 338 E CPIC E P + C H +C C++ W+ TCP+ R+ Sbjct: 258 ESKSCPICLEEFTPETPTRLLVCGHKYCEPCLSRWLENNTTCPICRK 304 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 4/74 (5%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRAC---ITEWISRQPTCPVDRQAVT-ASQLRPVP 371 EE C IC VLE PL + C+H+ C C E + P CP+ ++ + + L+ P Sbjct: 170 EEFHCAICLDVLEKPLSS-KCQHSCCSDCWKSAFELGEKHPACPICQETLADPNDLQRAP 228 Query: 372 RILRNLLSRLCTSC 413 +L LL C Sbjct: 229 LVLIQLLEGYLVKC 242 >SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 41.9 bits (94), Expect = 0.001 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 4/75 (5%) Frame = +3 Query: 201 DEELICPICSGVLEDPLQAPACEHAFCRAC---ITEWISRQPTCPVDRQAVT-ASQLRPV 368 +EE C IC VLE PL + C+H+ C C + + P CP+ ++ + + LR Sbjct: 20 NEEFHCAICLDVLEKPLSS-KCQHSCCSDCWESAFDLGEKHPACPICQETLADPNDLRRA 78 Query: 369 PRILRNLLSRLCTSC 413 P +L L+ C Sbjct: 79 PLVLIQLIEGYLVKC 93 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = +3 Query: 180 KRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACI----TEWISRQPTCPVDRQAVT 347 K G +++E CP+C +P P C H CR C+ T+ S++ CPV R+ T Sbjct: 11 KTLSGVINDECSCPVCLEDFLEPKSLPNCAHNVCRKCLEGMATDSESKEIRCPVCRKEST 70 >SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 4/74 (5%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRAC---ITEWISRQPTCPVDRQAVT-ASQLRPVP 371 EE C IC VLE PL + C+H+ C C E + P CP+ ++ + + L+ P Sbjct: 168 EEFHCAICLDVLEKPLSS-KCQHSCCSDCWKSAFELGGKHPACPICQETLADPNDLQRAP 226 Query: 372 RILRNLLSRLCTSC 413 +L LL C Sbjct: 227 LVLIQLLEGYLIKC 240 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/65 (29%), Positives = 24/65 (36%) Frame = +3 Query: 162 DMGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQA 341 D ++ + + CPIC + P C H FCR CITE CP R Sbjct: 660 DSTLDVDMTEDGAGDSAECPICLETITYPETLQGCGHTFCRPCITEASKSSKLCPTCRDP 719 Query: 342 VTASQ 356 Q Sbjct: 720 FGVQQ 724 >SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) Length = 576 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Frame = +3 Query: 171 FEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPT----CPVDR 335 + + F + +E CP+C V E+P P+C H CR C+ + +R + CP+ R Sbjct: 7 YTLPDFHTLLGDEGACPVCIEVFEEPKSLPSCAHNVCRECLEKITARNSSRFVECPICR 65 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/65 (29%), Positives = 24/65 (36%) Frame = +3 Query: 162 DMGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQA 341 D ++ + + CPIC + P C H FCR CITE CP R Sbjct: 735 DSTLDVDMTEDGAGDSAECPICLETITYPETLQGCGHTFCRPCITEASKSSKLCPTCRDP 794 Query: 342 VTASQ 356 Q Sbjct: 795 FGVQQ 799 >SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +3 Query: 186 FQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQP----TCPVDRQAV 344 F ++ +E+ CPIC E+P P C H CR C+ I + CP+ R V Sbjct: 15 FHENIQDEISCPICYEDFEEPKCLPKCAHNICRECLLGIIEKAQLERFECPICRAIV 71 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 216 CPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQL 359 CP+C+ V +P C + FC CI ++ + CPV T QL Sbjct: 1201 CPLCAKVRTNPTALSTCGYVFCYPCIYRYLGQHGCCPVTHLPSTQQQL 1248 >SB_33822| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0022) Length = 229 Score = 40.7 bits (91), Expect = 0.003 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 3/104 (2%) Frame = +3 Query: 180 KRFQ-GDV-DEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTA- 350 KRF+ +V ++ CPICS +L+ P++ H C AC+T+ ++ +CPV + +++ Sbjct: 119 KRFELNEVRKDDFYCPICSELLDKPVET-IFTHNACGACLTQALAVNSSCPVCKTILSSG 177 Query: 351 SQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVEC 482 ++ R L L+ C GC ++ H EC Sbjct: 178 DDIKKFNRTLLGLIESQIYKC----KGCGKEVQYQHCREH--EC 215 >SB_20533| Best HMM Match : U-box (HMM E-Value=9.6e-25) Length = 223 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/60 (31%), Positives = 31/60 (51%) Frame = +3 Query: 186 FQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRP 365 F DV E ICPI + +++ P+ A + + R I W+ R P+ + +T + LRP Sbjct: 147 FDTDVPFEFICPITNEIMKHPVSI-ADGYTYERRAIKSWLRRNSNSPMTNEPITDTTLRP 205 >SB_35671| Best HMM Match : zf-C3HC4 (HMM E-Value=0.01) Length = 527 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 1/94 (1%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTA-SQLRPVPRIL 380 ++ CPICS +L+ P++ H C AC+T+ ++ CPV + +++ ++ R L Sbjct: 248 DDFYCPICSELLDKPVET-IFTHNACDACLTQALAVNSLCPVCKTILSSGDDIKKFNRTL 306 Query: 381 RNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVEC 482 L+ C GC ++ H EC Sbjct: 307 LGLIESQIYKC----KGCGKEVQYQHCGEH--EC 334 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 39.9 bits (89), Expect = 0.005 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRAC---ITEWISRQPTCPVDRQAVT-ASQLRPVP 371 EE C IC VLE PL + C+H+ C C E + P CP+ ++ + + L+ P Sbjct: 315 EEFHCAICLDVLEKPLSS-KCQHSCCSDCWKSAFELGEKHPACPICQETLADPNDLQRAP 373 Query: 372 RILRNLL 392 +L LL Sbjct: 374 LVLIQLL 380 >SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) Length = 549 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Frame = +3 Query: 195 DVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQP---TCPVDRQAVTASQLRP 365 D+ EE+ C C+G+ EDP P C H+ C+ C+ + Q CPV V Sbjct: 14 DLPEEIWCRYCNGIFEDPRLLP-CLHSLCKKCLKDIEQAQEGAIACPVCLTDVECHLEEL 72 Query: 366 VPRIL 380 +P +L Sbjct: 73 LPNVL 77 >SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) Length = 169 Score = 39.5 bits (88), Expect = 0.007 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +3 Query: 195 DVDEELICPICSGVLEDPLQAPACEHAFCRACITEWI--SRQPTCP 326 D++ + C +C G L P C H FC++CI ++ S TCP Sbjct: 57 DLNPFITCGLCEGYLIKPTTITECLHTFCKSCIVTYLQDSEDNTCP 102 >SB_23054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 216 CPICSGVLEDPLQAPA---CEHAFCRACITEWISRQPTCPVDRQAVTASQL 359 C +C PLQ C H F R CI W++ Q CPVD Q V S + Sbjct: 212 CGVCLSAYH-PLQYVRKLQCRHVFHRDCIDSWLATQSICPVDGQTVGVSYM 261 >SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) Length = 96 Score = 39.5 bits (88), Expect = 0.007 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +3 Query: 210 LICPICSGVLEDPLQAPACEHAFCRACITEWISRQP---TCPVDRQ 338 L+CPIC +DP + P C H C C+ + + CP+D Q Sbjct: 20 LVCPICEEEYDDPKRLP-CMHTICLGCLESMVPKNALIMKCPIDEQ 64 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = +3 Query: 174 EIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVD 332 EI F +L CP+C V +DP+ +C H FC+ACI CP+D Sbjct: 180 EIILFVDKPSPKLFCPLCRRVFKDPV-ITSCGHTFCQACI--MARGVEKCPLD 229 >SB_31765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/92 (23%), Positives = 45/92 (48%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPRILR 383 ++ CPICS +L+ P++ H C AC+T+ ++ +CPV + +++ + + + Sbjct: 108 DDFYCPICSELLDKPVET-IFTHNACGACLTQALAVNSSCPVCKTILSSGD--DIKKFNQ 164 Query: 384 NLLSRLCTSCDNAPHGCNAVLKLDSLANHLVE 479 + LC + K + L +H+VE Sbjct: 165 QDIKLLCGYYRETVPDESFPSKFNMLEHHVVE 196 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAP---ACEHAFCRACITEWISRQPTCPVDRQAV 344 E L CPIC ED + P AC H C+AC+++ Q CP D+ V Sbjct: 10 EFLTCPICYHEFEDRQRGPISLACGHTICKACLSQLHKTQ--CPFDQATV 57 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 39.1 bits (87), Expect = 0.009 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 201 DEELICPICSGVLEDPLQAPACEHAFCRACITEWI 305 D+EL CP C +++P Q C H +CR C+T I Sbjct: 1947 DQEL-CPACFCEVDNPYQLATCGHVYCRGCVTNLI 1980 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = +3 Query: 195 DVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPR 374 ++D + CP+C P++ P C H FC CI R C + RQ ++ L P Sbjct: 64 ELDYQPDCPVCLQQASYPVRLP-CGHMFCFLCIKGVALRSRKCAICRQPISPDYL-DKPT 121 Query: 375 ILRNLLSRLCTSCDNAP 425 +++ ++S +S D AP Sbjct: 122 LVK-VVSGQSSSSDKAP 137 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 38.7 bits (86), Expect = 0.013 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 4/74 (5%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRAC---ITEWISRQPTCPVDRQAVT-ASQLRPVP 371 EE C IC VLE PL + C+H+ C C E + P CP+ ++ + + L+ Sbjct: 312 EEFHCAICLDVLEKPLSS-KCQHSCCSDCWKSAFELGEKHPACPICQETLADPNDLQRAA 370 Query: 372 RILRNLLSRLCTSC 413 +L LL C Sbjct: 371 LVLIQLLEGYLVKC 384 Score = 36.7 bits (81), Expect = 0.051 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRAC---ITEWISRQPTCPVDRQAVT-ASQLRPVP 371 EE C IC VLE PL + C+H+ C C E + P CP+ ++ + + L+ Sbjct: 638 EEFHCAICLDVLEKPLSS-KCQHSCCSDCWKSAFELGEKHPACPICQETLADPNDLQRAA 696 Query: 372 RILRNLL 392 +L LL Sbjct: 697 LVLIQLL 703 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 38.7 bits (86), Expect = 0.013 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 186 FQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISR 311 F ++ +C IC V++DP+ +C H++C+ CI +W +R Sbjct: 20 FLSPPSDDSMCAICHIVVKDPILT-SCGHSYCKCCIQKWRNR 60 >SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) Length = 818 Score = 38.3 bits (85), Expect = 0.017 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACI-TEWISRQPTCP 326 V EL CP+C +L D + P C ++C CI T + + CP Sbjct: 53 VPSELRCPMCKNLLTDTVLIPCCGTSYCDECIRTYLLENEQECP 96 >SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) Length = 406 Score = 38.3 bits (85), Expect = 0.017 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Frame = +3 Query: 171 FEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQP----TCPVDR 335 ++ F + +E CP+C V +P P+C H CR C+ + R CP+ R Sbjct: 7 YKFPEFHTLLGDEGACPVCIEVFVEPKSLPSCAHNVCRECLEKITKRNSIRFVECPICR 65 >SB_54922| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0028) Length = 116 Score = 38.3 bits (85), Expect = 0.017 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACI-TEWISRQPTCP 326 V EL CP+C +L D + P C ++C CI T + + CP Sbjct: 53 VPSELRCPMCKNLLTDTVLIPCCGTSYCDECIRTYLLENEQECP 96 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 38.3 bits (85), Expect = 0.017 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +3 Query: 213 ICPICSGVLEDPLQAPACEHAFCRACITEWISRQP---TCPVDRQAVTASQLRPVPRILR 383 IC +C DP AP C H+FC+ C+T+ ++ + CP D QA ++ V + + Sbjct: 404 ICGVCRETYTDPRVAP-CLHSFCKECVTKLVTERQGKFVCP-DCQADFQMSVKDVENLSQ 461 Query: 384 N 386 N Sbjct: 462 N 462 >SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 37.5 bits (83), Expect = 0.029 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTC 323 + L C +C G++ DP + +C H CR C+ + + P C Sbjct: 37 QSLSCRVCRGLVVDPFGSQSCLHYVCRGCLRKKRALNPGC 76 >SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) Length = 351 Score = 37.5 bits (83), Expect = 0.029 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTC 323 + L C +C G++ DP + +C H CR C+ + + P C Sbjct: 37 QSLSCRVCRGLVVDPFGSQSCLHYVCRGCLRKKRALNPGC 76 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 37.5 bits (83), Expect = 0.029 Identities = 32/106 (30%), Positives = 45/106 (42%), Gaps = 15/106 (14%) Frame = +3 Query: 210 LICPICSGVLEDPLQAPACEHAFCRACITEWISRQ------PTC----PVDRQAVTASQL 359 L+C IC +P P C H+FC+ C+ + I Q PTC PV + + A Sbjct: 15 LVCGICQETYNNPKVLP-CLHSFCQNCLDKSIRSQERVLVCPTCQCSVPVPAKGIEAF-- 71 Query: 360 RPVPRILRNLLSRLC----TSCDNAPHGCNAVLK-LDSLANHLVEC 482 PV + N+L+ L T C N A + LD + N C Sbjct: 72 -PVNFFINNMLTVLAVQNPTKCTNCEDSAQASARCLDCVENLCTNC 116 >SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.029 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +3 Query: 216 CPICSGVLE--DPLQAPACEHAFCRACITEWISRQPTCPVDR 335 CPIC G E + + C+H F CI W+ + +CPV R Sbjct: 62 CPICLGDYEKGESTKQMPCDHLFHPGCILPWLEKTNSCPVCR 103 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 37.5 bits (83), Expect = 0.029 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 189 QGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWI 305 Q D+ ++L C IC +L D P C H +CR CI + I Sbjct: 136 QDDIRQQLACGICHALLRDARVLP-CLHTYCRRCIEDII 173 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 37.5 bits (83), Expect = 0.029 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPT----CPVDRQAV 344 +EL+CPIC ++P + +C H CR C+ + +R+ + CP+ R + Sbjct: 17 DELLCPICLDEFKEP-KTLSCMHDLCRKCLEDMAARESSRVIRCPLCRSEI 66 >SB_7109| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0029) Length = 232 Score = 37.1 bits (82), Expect = 0.038 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 1/105 (0%) Frame = +3 Query: 171 FEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTA 350 FE+ + D + CPIC +L+ P++ H C AC+T+ ++ +CPV + +++ Sbjct: 74 FELNEIRKD---DFYCPICCELLDKPVET-IFTHNACGACLTQALAVNSSCPVCKTILSS 129 Query: 351 -SQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVEC 482 ++ L L+ C GC ++ H EC Sbjct: 130 GDDIKKFNHTLLGLIESQIYKC----KGCGKEVQYQHCGEH--EC 168 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 37.1 bits (82), Expect = 0.038 Identities = 28/104 (26%), Positives = 39/104 (37%), Gaps = 9/104 (8%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPT-----CPVDRQAVTASQLR 362 + +E+ CPIC +DP P C H FC C+ SR T CP + V S Sbjct: 10 LQKEVECPICLERFKDPRVLP-CLHTFCYECLVGLASRYKTEGKWPCPQCKMVVQVSPAE 68 Query: 363 ----PVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVEC 482 V ++ LLS + +A C D +C Sbjct: 69 VSSLKVNFLMNTLLSVVTNDSKSAKPHCQMCTSQDHAKGGCTDC 112 >SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 37.1 bits (82), Expect = 0.038 Identities = 18/67 (26%), Positives = 29/67 (43%) Frame = +3 Query: 123 KETDVIQSSTKKADMGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEW 302 ++ D + S + + + Q VD + +CPIC + P C H CR+CIT Sbjct: 399 RQLDALVSYLDEQSSQMRLLQKQESVDVDELCPICCAMRISVRFLP-CRHVSCRSCITRH 457 Query: 303 ISRQPTC 323 + C Sbjct: 458 LMNNKEC 464 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 37.1 bits (82), Expect = 0.038 Identities = 28/104 (26%), Positives = 39/104 (37%), Gaps = 9/104 (8%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPT-----CPVDRQAVTASQLR 362 + +E+ CPIC +DP P C H FC C+ SR T CP + V S Sbjct: 10 LQKEVECPICLERFKDPRVLP-CLHTFCYECLVGLASRYKTEGKWPCPQCKMVVQVSPAE 68 Query: 363 ----PVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVEC 482 V ++ LLS + +A C D +C Sbjct: 69 VSSLKVNFLMNTLLSVVTNGSKSAKPHCQMCTSQDHAKGGCTDC 112 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 36.7 bits (81), Expect = 0.051 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITE 299 E+L+CP+C G ++P+ C H+FC C+ E Sbjct: 16 EQLMCPVCLGEYKNPMLL-RCYHSFCLRCVQE 46 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 36.7 bits (81), Expect = 0.051 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 183 RFQGDVDEELICPICSGVLEDPLQAPACEHAFCRAC 290 +F+ +DE C IC VL++PLQ C H C +C Sbjct: 23 QFEKLLDERFRCTICKHVLQEPLQT-TCGHRICESC 57 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 36.3 bits (80), Expect = 0.067 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 9/89 (10%) Frame = +3 Query: 195 DVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQ------PTCPVDRQAVTASQ 356 ++ + L C +C ++ P P C H+FC AC+ + ++ P C + + V+ + Sbjct: 13 ELSKHLNCSLCHRLIRGPKLLP-CLHSFCLACLEDLVTENDVGFNCPQCHTEAK-VSKAA 70 Query: 357 LRPVPR--ILRNLLS-RLCTSCDNAPHGC 434 LR +P L N+L L S D+ P C Sbjct: 71 LRGLPTNFFLDNMLDIALMNSSDSKPVPC 99 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 36.3 bits (80), Expect = 0.067 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC L DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSICIEHLNDPRVLP-CLHSFCRHCLEE 41 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 35.9 bits (79), Expect = 0.089 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVT 347 ++ C +C +L +P+ + C H+FCR C+ + + CP R +T Sbjct: 326 DDFECKLCFNLLLEPVTS-LCGHSFCRDCLYRSLDHRVECPCCRAPLT 372 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 35.9 bits (79), Expect = 0.089 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACITEWI---SRQPTCPVDRQA 341 EEL CP+C L++P +C H C+ C+ ++ CP R++ Sbjct: 13 EELTCPVCLEELKEPKCLTSCAHNVCKPCLDRMTFNGEKEIRCPTCRRS 61 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 35.5 bits (78), Expect = 0.12 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 207 ELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPV 329 ++ C +C G +DP + AC H +CR C+ + C V Sbjct: 14 DVTCSLCLGQYQDP-RVLACLHTYCRHCLESLVEHSKECTV 53 >SB_4569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.5 bits (78), Expect = 0.12 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = +3 Query: 318 TCPVDRQAVTASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLV-ECEFNP 494 +CP+DR+ + A +RPV I +++ L + C+ C L+ A+HL EC Sbjct: 10 SCPLDRRPLMAEDMRPVITI-NAIINSLTSKCE-----CGWTGPLERHADHLARECN--- 60 Query: 495 KRPMPCE-AGCGLVIPKDELADH 560 +R + CE C + I ELA H Sbjct: 61 ERLVRCENVSCPMQIAHRELAGH 83 >SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 35.5 bits (78), Expect = 0.12 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 174 EIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQP 317 +I+ +++E L C CS V ++P P C H+FC C+ E +P Sbjct: 2 DIQSILENLEELLTCRQCSNVFKNPRITP-CLHSFCAECLNEIARSRP 48 >SB_55521| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-24) Length = 567 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 411 CDNAPHGCNAVLKLDSLANHLVECEFNPKRPMPCEAGCGLVIPK 542 C N PHGC +L NH +CEFNP + E G L + K Sbjct: 90 CVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECGKKLSVAK 133 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 35.1 bits (77), Expect = 0.15 Identities = 35/157 (22%), Positives = 58/157 (36%) Frame = +3 Query: 192 GDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVP 371 GDV +++ C +C +DP + AC H +CR C+ + C V+ Q R Sbjct: 9 GDV-KDVTCCLCLEQYQDP-RVLACLHTYCRHCLESLVEHSKEC-----TVSCPQCREKI 61 Query: 372 RILRNLLSRLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKRPMPCEAGCGLVIPKDEL 551 I + + L + N +L ++ N + CE P + G + E Sbjct: 62 EISVDEVEELKVNFMLKDLIENMLLDQENKVNISISCE-----TCPTDHASGRCVDCSEF 116 Query: 552 ADHNCVRELRALIATQQGKLNDYQLELAEQRLVINEH 662 C+ R L T+Q + Q A+ H Sbjct: 117 MCDFCIESHRRLFRTRQHTIISLQEATAKSTTSCKSH 153 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSICIEHFNDPRVLP-CFHSFCRHCLEE 41 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSICIEHFNDPRVLP-CLHSFCRHCLEE 41 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSICIEHFNDPRVLP-CFHSFCRHCLEE 41 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSICIEHFNDPRVLP-CFHSFCRHCLEE 41 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSICIEHFNDPRVLP-CLHSFCRHCLEE 41 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSICIEHFNDPRVLP-CFHSFCRHCLEE 41 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 8 LEDEVTCSICIEHFNDPRVLP-CFHSFCRHCLEE 40 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 + +E+ C IC +DP P C H+FCR C+ E Sbjct: 14 LQDEVTCSICIEHFDDPRVLP-CLHSFCRHCLEE 46 >SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) Length = 671 Score = 34.7 bits (76), Expect = 0.20 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 5/63 (7%) Frame = +3 Query: 216 CPICSGVLE-----DPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPRIL 380 CP S +L+ +P+ P +H FC C+ W+ CP R + Q PV +IL Sbjct: 98 CPTKSAILDLEKVKEPVVCPN-QHVFCSPCLDLWLRTNRYCPTCRTPINQDQ--PVKKIL 154 Query: 381 RNL 389 ++ Sbjct: 155 GSM 157 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSICIEHFNDPRVLP-CLHSFCRHCLEE 41 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 8 LEDEVTCSICIEHFNDPRVLP-CLHSFCRHCLEE 40 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 34.3 bits (75), Expect = 0.27 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 12/90 (13%) Frame = +3 Query: 201 DEELICPICSGVLEDPLQAPACEHAFCRACITEWISR-----QPTCPVDRQAV--TASQL 359 ++++ C +C + DP P C H +C+ C+ + +S+ + CP R V T +Q+ Sbjct: 11 EKDVTCLLCLDIFTDPRLLP-CLHTYCKKCLEDLVSQCQKKGEIYCPQCRHEVKITCAQV 69 Query: 360 R--PVPRILRNLLSRLC-TSCDNA--PHGC 434 + + ++++ L TS +NA P GC Sbjct: 70 SNLKINTVANDIIAALALTSEENADSPPGC 99 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 34.3 bits (75), Expect = 0.27 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 20/91 (21%) Frame = +3 Query: 204 EELICPICSGVLEDPLQAPACEHAFCRACI------TEWISRQ--PTCP-----VDRQAV 344 E L C C G ++P + P C HAFC C+ T+ R PTC VD A+ Sbjct: 14 ERLTCSACKGFYKNPKRLP-CLHAFCCHCLKKTQRGTKLCERMRCPTCDYELDLVDSVAI 72 Query: 345 TA-------SQLRPVPRILRNLLSRLCTSCD 416 A S+++ + R R L C SC+ Sbjct: 73 DALPVPYYISRVQEIVRCHRGKLELACNSCE 103 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 34.3 bits (75), Expect = 0.27 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +3 Query: 216 CPICSGVLEDPLQAPACEHAFCRACITEWISRQPT---CPVDRQAVTASQLRPV 368 C IC D + + C H FC C+ W+ +P CPV + ++ ++ P+ Sbjct: 63 CNICLDTARDAVIS-MCGHLFCWPCLHRWLETRPNRSMCPVCKAGISKEKVIPL 115 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 3/68 (4%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACI--TEWISR-QPTCPVDRQAVTASQLRPV 368 V EEL C +C +P P C H FC+ C+ T+ R CP R + ++ + Sbjct: 16 VREELTCSVCLEQFREPKMLP-CFHTFCKECLEKTKQSFRGNLLCPTCRTKTSVTEHEMI 74 Query: 369 PRILRNLL 392 ++ N + Sbjct: 75 QKLPNNFI 82 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 33.9 bits (74), Expect = 0.36 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C +C DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSLCIEHFNDPRVLP-CLHSFCRHCLEE 41 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 33.9 bits (74), Expect = 0.36 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEDEVRCSICIEHFNDPRVLP-CFHSFCRHCLEE 41 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 33.9 bits (74), Expect = 0.36 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 213 ICPICSGVLEDPLQAPACEHAFCRACITEWISR 311 +CP C E+P P C H FC C++E + R Sbjct: 14 VCPKCMNAYENPKVLP-CLHTFCSQCLSEELHR 45 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 33.9 bits (74), Expect = 0.36 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C +C DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSLCIEHFNDPRVLP-CLHSFCRHCLEE 41 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 33.9 bits (74), Expect = 0.36 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C +C DP P C H+FCR C+ E Sbjct: 129 LEDEVTCSLCIEHFNDPRVLP-CLHSFCRHCLEE 161 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 33.9 bits (74), Expect = 0.36 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 + +E+ C IC DP P C H+FCR C+ E Sbjct: 9 LQDEVTCSICIEHFNDPRVLP-CFHSFCRHCLEE 41 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 33.9 bits (74), Expect = 0.36 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +3 Query: 213 ICPICSGVLE--DPLQAPACEHAFCRACITEWISR-QPTCPVDRQAVTASQ 356 +C IC + D L+ C+HA+ C+ W++ + TCPV ++ V S+ Sbjct: 300 VCAICLDEYKEGDKLRILPCDHAYHCKCVDPWLTEGKRTCPVCKRPVETSK 350 >SB_13095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 33.9 bits (74), Expect = 0.36 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +3 Query: 177 IKRFQGDVDEELICPICSGVLE-DPLQAPACEHAFCRACITEWISRQPTC 323 +++ G+ IC CS LE P C+H CR C+T + Q TC Sbjct: 440 MRQTPGEKLRSTICKSCSRSLEKQPAFQLPCKHLICRGCLTGRTAGQMTC 489 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 33.9 bits (74), Expect = 0.36 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C +C DP P C H+FCR C+ E Sbjct: 9 LEDEVTCSLCIEHFNDPRVLP-CFHSFCRHCLEE 41 >SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 33.5 bits (73), Expect = 0.47 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 216 CPIC-SGVLEDPLQAP-ACEHAFCRACITEW 302 CP+C + E L P +C H FC CI EW Sbjct: 102 CPVCLMSLSEQKLGTPNSCMHVFCLECILEW 132 >SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) Length = 2007 Score = 33.5 bits (73), Expect = 0.47 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = -2 Query: 580 RNSRTQLWSASSSFGITKPHPASQGIGL--FGLNSHSTK*LARESSFKTALQPCGALSQL 407 RN +TQ WS+SSS T P+ + GI + G +S+ST+ S+ +P S + Sbjct: 159 RNGKTQFWSSSSS-SPTVPNKTTNGISVPSVGRSSYSTRVSPITSALAPEQRPILG-SSI 216 Query: 406 VHNLDSRLRSILG 368 V N + +I+G Sbjct: 217 VRNFEPERLNIVG 229 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 33.1 bits (72), Expect = 0.62 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 ++ E+ C IC DP P C H+FCR C+ E Sbjct: 9 LEGEVTCSICIEHFNDPRVLP-CLHSFCRHCLEE 41 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 32.7 bits (71), Expect = 0.82 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +3 Query: 210 LICPICSGVLEDPLQAPACEHAFCRACITEWI---SRQPTCPVDRQAVTASQ 356 L CP+C + +P P C H FC+ C+ + S +CP R V + Sbjct: 143 LFCPLCHEMFANPRLLP-CLHTFCKRCLENLVPPRSHTLSCPSCRLDVALGE 193 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 32.7 bits (71), Expect = 0.82 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H FCR C+ + Sbjct: 9 LEDEVTCAICIEHFTDPRLLP-CLHTFCRHCLED 41 >SB_4351| Best HMM Match : zf-B_box (HMM E-Value=1.3e-25) Length = 662 Score = 32.7 bits (71), Expect = 0.82 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 5/58 (8%) Frame = +3 Query: 195 DVDEE---LICPIC--SGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTAS 353 DVDE+ +IC IC S +P P C H+FC C+ E +Q + + T+S Sbjct: 12 DVDEDSVFMICGICRKSSATSNPKLLP-CLHSFCFGCLEEKFDQQQQQEQKQNSTTSS 68 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 32.3 bits (70), Expect = 1.1 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 207 ELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPV 329 ++ C +C +DP + AC H +CR C+ + C V Sbjct: 23 DVTCSLCLEQYQDP-RVLACLHTYCRHCLESLVEHSKECTV 62 >SB_11979| Best HMM Match : zf-C3HC4 (HMM E-Value=0.061) Length = 63 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPV 368 V E++ C IC PL + +C H C C + + CP + + LR + Sbjct: 5 VTEKVKCLICMEPYTVPLVSISCWHVHCEECWLRTLGAKKLCPQCNMITSPNDLRKI 61 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 198 VDEELICPICSGVLEDPLQAPACEHAFCRACITE 299 +++E+ C IC DP P C H+FC C+ E Sbjct: 9 LEDEVTCSICIEHFNDPRVLP-CFHSFCLHCLEE 41 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +3 Query: 207 ELICPICSGVLEDPLQAPACEHAFCRACITEWI----SRQPTCPVDRQAVTAS 353 ++ C +C +DP + AC H +CR C+ + R +CP R+ + S Sbjct: 14 DVTCSLCLEQYQDP-RVLACLHTYCRHCLESLVEHSQERTVSCPQCREKIVIS 65 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +3 Query: 207 ELICPICSGVLEDPLQAPACEHAFCRACITEWI----SRQPTCPVDRQAVTAS 353 ++ C +C +DP + AC H +CR C+ + R +CP R+ + S Sbjct: 14 DVTCSLCLEQYQDP-RVLACLHTYCRHCLESLVEHSQERTVSCPQCREKIVIS 65 >SB_4080| Best HMM Match : zf-C3HC4 (HMM E-Value=0.23) Length = 203 Score = 31.5 bits (68), Expect = 1.9 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +3 Query: 264 CEHAFCRACITEWISRQPTCPVDRQA---VTASQLRPVPRILRNLLSRLCTSCDNAPH 428 C H+FC +C ++W+ CP + A + +L + + L L + TS D+ H Sbjct: 81 CMHSFCASCYSQWMEHSRDCPSNYLAGKNIGVDEL--LQKCLEKLDVKAYTSIDSTRH 136 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 31.1 bits (67), Expect = 2.5 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 8/81 (9%) Frame = +3 Query: 192 GDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQP----TCPVDRQAVTAS-- 353 GDV +++ C +C +DP + AC H +CR C+ +CP R+ + S Sbjct: 9 GDV-KDVTCCLCLEQYQDP-RVLACLHTYCRHCLESLAEHSQGDSISCPQCREKIQISVD 66 Query: 354 --QLRPVPRILRNLLSRLCTS 410 Q +L NL+ R+ S Sbjct: 67 KVQNLKEDFLLSNLIKRISLS 87 >SB_43575| Best HMM Match : Sina (HMM E-Value=0) Length = 432 Score = 31.1 bits (67), Expect = 2.5 Identities = 34/132 (25%), Positives = 48/132 (36%), Gaps = 1/132 (0%) Frame = +3 Query: 216 CPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPRILRNLLS 395 CP+C + P+ + H C C + ++ PTC ++ + V N +S Sbjct: 37 CPVCFDYVLPPILQCSSGHLVCSNCRPK-LTCCPTCRGPLGSIRNLAMEKVA----NTVS 91 Query: 396 RLCTSCDNAPHGCNAVLKLDSLANHLVECEFNPKRPMPCE-AGCGLVIPKDELADHNCVR 572 C A GC L A H CEF P PC A C D + H + Sbjct: 92 ---FPCKYANSGCEVNLPHTEKAEHEESCEFRP-YSCPCPGASCKWQGSLDAVMPH--LM 145 Query: 573 ELRALIATQQGK 608 I T QG+ Sbjct: 146 HTHKSITTLQGE 157 >SB_11968| Best HMM Match : zf-TRAF (HMM E-Value=0.32) Length = 144 Score = 31.1 bits (67), Expect = 2.5 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 8/93 (8%) Frame = +3 Query: 282 RACITEWISR-------QPTCPVDRQAVTASQLRPVPRILRNLLSRLCTSCDNAPHGCNA 440 RAC+ + +S +P CP+DR+ + A +RPV I+ ++ L + C+ C Sbjct: 4 RACVLQILSADTCPGIPEPACPLDRRPLIAEDIRPV-IIVNAIVKCLLSQCE-----CGW 57 Query: 441 VLKLDSLANHLVECEFNPKRPMPCE-AGCGLVI 536 L+S A+ L E++ +R + CE GC + I Sbjct: 58 TGLLESHADRLAR-EWD-ERLVRCENVGCPMRI 88 >SB_42017| Best HMM Match : DUF1421 (HMM E-Value=0.43) Length = 565 Score = 30.7 bits (66), Expect = 3.3 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 4/133 (3%) Frame = +3 Query: 540 KDELADHNCVRELRALIATQQGKLNDYQLELAE---QRLVINEHKRELA-LLKGIYEGHA 707 K LADH EL L A ++ +L D++LELA+ Q I++ RE LL + Sbjct: 56 KQRLADHKL--ELADLDAQEKQRLADHKLELADLDAQEKAIDQRLREAKHLLHHTSQARL 113 Query: 708 CIEPYYASSC*PDGTRGSSPLGEFPYHEQESRAWGGMISTPDDVLQMMIXRSXLRVGMPA 887 ++ S + R +PL F +S+++ +TPD + + + +PA Sbjct: 114 WLKTL-RSPIKVNFIR-PNPLSTFTAMRTKSKSFTAKATTPDALPAFIEATQQSQAALPA 171 Query: 888 FHIDHLMENWS*K 926 I N++ K Sbjct: 172 TKIPQSQANFAAK 184 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 29.9 bits (64), Expect = 5.8 Identities = 16/63 (25%), Positives = 28/63 (44%) Frame = +3 Query: 201 DEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPRIL 380 D LIC +C+ P + C H+FC++CI + ++ L +PR + Sbjct: 57 DPALICRVCNQRFNKP-KLLHCLHSFCQSCIEGLARKTEDDCLELICPVCDSLGAIPRSV 115 Query: 381 RNL 389 +L Sbjct: 116 ESL 118 >SB_59217| Best HMM Match : TRAUB (HMM E-Value=0.25) Length = 626 Score = 29.5 bits (63), Expect = 7.7 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 306 SRQPTCPVDRQAVTASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDS 458 S+ PT P+ Q A+ PVP+ ++ LS +PH + V LDS Sbjct: 374 SKSPTSPLSLQGSEAALTSPVPQ--QSELSTTSPMSSTSPHSSDLVSPLDS 422 >SB_47089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 29.5 bits (63), Expect = 7.7 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 306 SRQPTCPVDRQAVTASQLRPVPRILRNLLSRLCTSCDNAPHGCNAVLKLDS 458 S+ PT P+ Q A+ PVP+ ++ LS +PH + V LDS Sbjct: 29 SKSPTSPLSLQGSEAALTSPVPQ--QSELSTTSPMSSTSPHSSDLVSPLDS 77 >SB_44729| Best HMM Match : SET (HMM E-Value=0) Length = 1112 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 144 SSTKKADMGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACI 293 SSTK + + ++++ +GD + E +C +C V D + C A+ CI Sbjct: 390 SSTKSSTIS-KVRKDKGDKESEAVCAVCEQV-NDLMFCGDCNSAYHPDCI 437 >SB_21939| Best HMM Match : F-box (HMM E-Value=0.001) Length = 909 Score = 29.5 bits (63), Expect = 7.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 405 TSCDNAPHGCNAVLKLDSLANHLVEC 482 T C N+ +GC AVL +S+ +HL C Sbjct: 56 TPCTNSFYGCPAVLPRESIKSHLSIC 81 >SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) Length = 106 Score = 29.5 bits (63), Expect = 7.7 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 216 CPICSGVLEDPLQAPACEHAFCRACI 293 C ICS P Q ACEH FC CI Sbjct: 81 CSICSEPPTAPHQG-ACEHVFCYYCI 105 >SB_106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.5 bits (63), Expect = 7.7 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 8/41 (19%) Frame = +3 Query: 204 EELICPICSGV-LEDPLQA-------PACEHAFCRACITEW 302 E + C +C V + P Q+ P C HAFC CI +W Sbjct: 170 ENVTCAVCLDVVMSKPKQSERRFGILPNCIHAFCLECIRKW 210 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,033,828 Number of Sequences: 59808 Number of extensions: 657577 Number of successful extensions: 1518 Number of sequences better than 10.0: 131 Number of HSP's better than 10.0 without gapping: 1293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1471 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5129408549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -