BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030623sawa_G06_e47_14.seq (1568 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 31 0.12 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 31 0.12 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 4.5 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 30.7 bits (66), Expect = 0.12 Identities = 19/68 (27%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +3 Query: 201 DEELI--CPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPR 374 DEEL C +C DP+ C+H FC C + C + T P Sbjct: 240 DEELPFKCYVCRESFVDPI-VTKCKHYFCERCALAQYKKSSRCAI-CGVQTNGMFNPAKE 297 Query: 375 ILRNLLSR 398 ++ L SR Sbjct: 298 LIARLKSR 305 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 30.7 bits (66), Expect = 0.12 Identities = 19/68 (27%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +3 Query: 201 DEELI--CPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQAVTASQLRPVPR 374 DEEL C +C DP+ C+H FC C + C + T P Sbjct: 240 DEELPFKCYVCRESFVDPI-VTKCKHYFCERCALAQYKKSSRCAI-CGVQTNGMFNPAKE 297 Query: 375 ILRNLLSR 398 ++ L SR Sbjct: 298 LIARLKSR 305 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 4.5 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 621 QLELAEQRLVINEHKRELALLKGIYEGHACIEP 719 +LEL L++N +++L + ++E H I P Sbjct: 634 KLELRLTELIVNPLQQDLEIFNQVWEWHELISP 666 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,171,894 Number of Sequences: 2352 Number of extensions: 22403 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 184909725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -